Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4675845..4676630 | Replicon | chromosome |
| Accession | NZ_CP116810 | ||
| Organism | Rhodopseudomonas palustris CGA009 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | Q6N2B5 |
| Locus tag | TX73_RS21425 | Protein ID | WP_011159670.1 |
| Coordinates | 4675845..4676342 (-) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | TX73_RS21430 | Protein ID | WP_042441274.1 |
| Coordinates | 4676343..4676630 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| TX73_RS21395 (TX73_021395) | 4670966..4671316 | + | 351 | WP_011159664.1 | helix-turn-helix transcriptional regulator | - |
| TX73_RS21400 (TX73_021400) | 4671313..4672206 | + | 894 | WP_011159665.1 | ImmA/IrrE family metallo-endopeptidase | - |
| TX73_RS21405 (TX73_021405) | 4672421..4672885 | - | 465 | WP_011159666.1 | CopG family transcriptional regulator | - |
| TX73_RS21410 (TX73_021410) | 4672895..4674889 | - | 1995 | WP_011159667.1 | conjugal transfer protein TraG | - |
| TX73_RS21415 (TX73_021415) | 4675023..4675322 | - | 300 | WP_011159668.1 | DUF2285 domain-containing protein | - |
| TX73_RS21420 (TX73_021420) | 4675430..4675708 | + | 279 | WP_011159669.1 | helix-turn-helix transcriptional regulator | - |
| TX73_RS21425 (TX73_021425) | 4675845..4676342 | - | 498 | WP_011159670.1 | GNAT family N-acetyltransferase | Toxin |
| TX73_RS21430 (TX73_021430) | 4676343..4676630 | - | 288 | WP_042441274.1 | DUF1778 domain-containing protein | Antitoxin |
| TX73_RS21435 (TX73_021435) | 4676701..4676931 | - | 231 | Protein_4243 | DUF3363 domain-containing protein | - |
| TX73_RS21440 (TX73_021440) | 4676962..4678527 | + | 1566 | WP_065814273.1 | DNA topoisomerase | - |
| TX73_RS21450 (TX73_021450) | 4679132..4679563 | - | 432 | WP_011159672.1 | phasin | - |
| TX73_RS21455 (TX73_021455) | 4679787..4680170 | - | 384 | WP_011159673.1 | phasin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18315.15 Da Isoelectric Point: 8.8691
>T269257 WP_011159670.1 NZ_CP116810:c4676342-4675845 [Rhodopseudomonas palustris CGA009]
MTFRIEKLRREHHVEGFDCGKEPLNRFLLRYALQSQLSNSSQTYLALSQDEVVGFYTLAFGDVSYEDAPERLRKGVARHP
IPLMILARLAVASAWAGKGIGAGLLKDALARTLAAAEIAGLRAFAVHAKDDQARAFYERFDFIASPSDPMHLFVLLKDVR
ALIGP
MTFRIEKLRREHHVEGFDCGKEPLNRFLLRYALQSQLSNSSQTYLALSQDEVVGFYTLAFGDVSYEDAPERLRKGVARHP
IPLMILARLAVASAWAGKGIGAGLLKDALARTLAAAEIAGLRAFAVHAKDDQARAFYERFDFIASPSDPMHLFVLLKDVR
ALIGP
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|