Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2243487..2244157 | Replicon | chromosome |
| Accession | NZ_CP116810 | ||
| Organism | Rhodopseudomonas palustris CGA009 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q6N8B2 |
| Locus tag | TX73_RS10265 | Protein ID | WP_011157547.1 |
| Coordinates | 2243487..2243897 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | TX73_RS10270 | Protein ID | WP_011157548.1 |
| Coordinates | 2243894..2244157 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| TX73_RS10250 (TX73_010250) | 2239876..2240202 | + | 327 | WP_011157544.1 | hypothetical protein | - |
| TX73_RS10255 (TX73_010255) | 2240369..2242159 | + | 1791 | WP_011157545.1 | sulfatase-like hydrolase/transferase | - |
| TX73_RS10260 (TX73_010260) | 2242195..2243232 | + | 1038 | WP_042441504.1 | transporter | - |
| TX73_RS10265 (TX73_010265) | 2243487..2243897 | - | 411 | WP_011157547.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| TX73_RS10270 (TX73_010270) | 2243894..2244157 | - | 264 | WP_011157548.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| TX73_RS10275 (TX73_010275) | 2244338..2244763 | + | 426 | WP_011157549.1 | cupin domain-containing protein | - |
| TX73_RS10280 (TX73_010280) | 2244860..2246029 | - | 1170 | WP_011157550.1 | DUF2865 domain-containing protein | - |
| TX73_RS10285 (TX73_010285) | 2246215..2246523 | - | 309 | WP_011157551.1 | hypothetical protein | - |
| TX73_RS10290 (TX73_010290) | 2246924..2248315 | + | 1392 | WP_011157552.1 | cysteine--tRNA ligase | - |
| TX73_RS10295 (TX73_010295) | 2248312..2248848 | + | 537 | WP_147408398.1 | hypothetical protein | - |
| TX73_RS10300 (TX73_010300) | 2248845..2248976 | + | 132 | WP_011157553.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15136.48 Da Isoelectric Point: 5.6802
>T269254 WP_011157547.1 NZ_CP116810:c2243897-2243487 [Rhodopseudomonas palustris CGA009]
MSGWMLDTNVASHVIRGDRREIIERLVALPISDVVISSITEGELLYGLAKRGYPTALSERVREFLLRVDVLPWDHEVTKT
YADLRAVCEAKGVTLSPLDMMIAAHAAATNATLVTRDKAFSRVPSPLRIEDWAEMS
MSGWMLDTNVASHVIRGDRREIIERLVALPISDVVISSITEGELLYGLAKRGYPTALSERVREFLLRVDVLPWDHEVTKT
YADLRAVCEAKGVTLSPLDMMIAAHAAATNATLVTRDKAFSRVPSPLRIEDWAEMS
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|