Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1049766..1050305 | Replicon | chromosome |
Accession | NZ_CP116807 | ||
Organism | Mammaliicoccus lentus strain PVZ.22 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A178P0V5 |
Locus tag | PN942_RS05355 | Protein ID | WP_016999692.1 |
Coordinates | 1049766..1050137 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A4Y9KBD3 |
Locus tag | PN942_RS05360 | Protein ID | WP_016999693.1 |
Coordinates | 1050138..1050305 (-) | Length | 56 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PN942_RS05335 (PN942_05330) | 1047036..1047806 | - | 771 | WP_016999688.1 | RNA polymerase sigma factor SigB | - |
PN942_RS05340 (PN942_05335) | 1047781..1048257 | - | 477 | WP_016999689.1 | anti-sigma B factor RsbW | - |
PN942_RS05345 (PN942_05340) | 1048259..1048585 | - | 327 | WP_016999690.1 | anti-sigma factor antagonist | - |
PN942_RS05350 (PN942_05345) | 1048658..1049662 | - | 1005 | WP_016999691.1 | PP2C family protein-serine/threonine phosphatase | - |
PN942_RS05355 (PN942_05350) | 1049766..1050137 | - | 372 | WP_016999692.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PN942_RS05360 (PN942_05355) | 1050138..1050305 | - | 168 | WP_016999693.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PN942_RS05365 (PN942_05360) | 1050392..1051540 | - | 1149 | WP_016999694.1 | alanine racemase | - |
PN942_RS05370 (PN942_05365) | 1051588..1051956 | - | 369 | WP_016999695.1 | holo-ACP synthase | - |
PN942_RS05375 (PN942_05370) | 1051953..1052453 | - | 501 | WP_016999696.1 | PH domain-containing protein | - |
PN942_RS05380 (PN942_05375) | 1052443..1053975 | - | 1533 | WP_016999697.1 | PH domain-containing protein | - |
PN942_RS05385 (PN942_05380) | 1053965..1054444 | - | 480 | WP_016999698.1 | PH domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13662.79 Da Isoelectric Point: 9.8460
>T269253 WP_016999692.1 NZ_CP116807:c1050137-1049766 [Mammaliicoccus lentus]
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDSAIAISLNLTLQYKFDTLGNT
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDSAIAISLNLTLQYKFDTLGNT
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A178P0V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y9KBD3 |