Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 875758..876505 | Replicon | chromosome |
| Accession | NZ_CP116807 | ||
| Organism | Mammaliicoccus lentus strain PVZ.22 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | PN942_RS04355 | Protein ID | WP_269141993.1 |
| Coordinates | 875758..875892 (-) | Length | 45 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | A0A178P7X5 |
| Locus tag | PN942_RS04360 | Protein ID | WP_016999960.1 |
| Coordinates | 875906..876505 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PN942_RS04345 (PN942_04340) | 872499..874025 | - | 1527 | WP_103269529.1 | Ppx/GppA family phosphatase | - |
| PN942_RS04350 (PN942_04345) | 874109..875497 | - | 1389 | WP_016999962.1 | class II fumarate hydratase | - |
| PN942_RS04355 (PN942_04350) | 875758..875892 | - | 135 | WP_269141993.1 | SAS053 family protein | Toxin |
| PN942_RS04360 (PN942_04355) | 875906..876505 | - | 600 | WP_016999960.1 | hypothetical protein | Antitoxin |
| PN942_RS04365 (PN942_04360) | 876550..877704 | - | 1155 | WP_016999959.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| PN942_RS04370 (PN942_04365) | 877792..877932 | + | 141 | WP_016999958.1 | hypothetical protein | - |
| PN942_RS04375 (PN942_04370) | 877959..878432 | - | 474 | WP_016999957.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| PN942_RS04380 (PN942_04375) | 878436..879563 | - | 1128 | WP_016999956.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| PN942_RS04385 (PN942_04380) | 879726..880487 | - | 762 | WP_016999955.1 | acetylglutamate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 5345.65 Da Isoelectric Point: 3.8462
>T269252 WP_269141993.1 NZ_CP116807:c875892-875758 [Mammaliicoccus lentus]
MDKHIDHNENEEENEMVQDLEDVKELGKEMEQISEQNDEEKEEK
MDKHIDHNENEEENEMVQDLEDVKELGKEMEQISEQNDEEKEEK
Download Length: 135 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22222.10 Da Isoelectric Point: 5.3603
>AT269252 WP_016999960.1 NZ_CP116807:c876505-875906 [Mammaliicoccus lentus]
MALNFKVFETKSIAARYAADIVRKQFNGDSTSVVGVHLNDENTTFFDELFDNVKKSPVNFSQIHVLDFDGKEDYYTELGV
PSKQVIKTDVGGDVESVIKDKVNTDKKKNKLMLNVLTLTDDSRIGLDYDSSIHPAREVVLLVTGKEKAKAVKQLYEEPAN
GSVDSAKLKQHRMVTVVLDNEAAQGLPEDVRSYFSIQFS
MALNFKVFETKSIAARYAADIVRKQFNGDSTSVVGVHLNDENTTFFDELFDNVKKSPVNFSQIHVLDFDGKEDYYTELGV
PSKQVIKTDVGGDVESVIKDKVNTDKKKNKLMLNVLTLTDDSRIGLDYDSSIHPAREVVLLVTGKEKAKAVKQLYEEPAN
GSVDSAKLKQHRMVTVVLDNEAAQGLPEDVRSYFSIQFS
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|