Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 6117326..6117974 | Replicon | chromosome |
| Accession | NZ_CP116775 | ||
| Organism | Pseudomonas sp. 273 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | - |
| Locus tag | PKO50_RS28060 | Protein ID | WP_275630539.1 |
| Coordinates | 6117639..6117974 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | - |
| Locus tag | PKO50_RS28055 | Protein ID | WP_089392940.1 |
| Coordinates | 6117326..6117646 (-) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PKO50_RS28045 | 6113289..6115067 | - | 1779 | WP_109931745.1 | acyl-CoA dehydrogenase C-terminal domain-containing protein | - |
| PKO50_RS28050 | 6115288..6117084 | - | 1797 | WP_275627855.1 | acyl-CoA dehydrogenase C-terminal domain-containing protein | - |
| PKO50_RS28055 | 6117326..6117646 | - | 321 | WP_089392940.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PKO50_RS28060 | 6117639..6117974 | - | 336 | WP_275630539.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PKO50_RS28065 | 6118181..6119986 | - | 1806 | WP_109931741.1 | phenylacyl-CoA dehydrogenase | - |
| PKO50_RS28070 | 6120291..6120518 | - | 228 | WP_089392938.1 | hypothetical protein | - |
| PKO50_RS28075 | 6120585..6121274 | - | 690 | WP_275627856.1 | dethiobiotin synthase | - |
| PKO50_RS28080 | 6121354..6122160 | - | 807 | WP_275627857.1 | malonyl-ACP O-methyltransferase BioC | - |
| PKO50_RS28085 | 6122153..6122878 | - | 726 | WP_275627858.1 | alpha/beta fold hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12188.80 Da Isoelectric Point: 6.6408
>T269247 WP_275630539.1 NZ_CP116775:c6117974-6117639 [Pseudomonas sp. 273]
MGSSKKDLLDMPEDVQDVFGFALHQAQEGGKHPQAKPMKGFSGAGVLEVVEDYDGDTYRAVYTVKLAAAVYALHCFQKKS
TRGIETPQHDIALIKKRLKDAEAHAKSVEND
MGSSKKDLLDMPEDVQDVFGFALHQAQEGGKHPQAKPMKGFSGAGVLEVVEDYDGDTYRAVYTVKLAAAVYALHCFQKKS
TRGIETPQHDIALIKKRLKDAEAHAKSVEND
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|