Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 6100092..6100710 | Replicon | chromosome |
Accession | NZ_CP116775 | ||
Organism | Pseudomonas sp. 273 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PKO50_RS27995 | Protein ID | WP_275627849.1 |
Coordinates | 6100528..6100710 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PKO50_RS27990 | Protein ID | WP_275627848.1 |
Coordinates | 6100092..6100496 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PKO50_RS27975 | 6095736..6099469 | + | 3734 | Protein_5523 | EAL domain-containing protein | - |
PKO50_RS27985 | 6099634..6099924 | - | 291 | WP_089392953.1 | helix-turn-helix domain-containing protein | - |
PKO50_RS27990 | 6100092..6100496 | - | 405 | WP_275627848.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PKO50_RS27995 | 6100528..6100710 | - | 183 | WP_275627849.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PKO50_RS28000 | 6101169..6101657 | + | 489 | WP_275627850.1 | Bro-N domain-containing protein | - |
PKO50_RS28005 | 6101916..6102074 | - | 159 | WP_009615518.1 | YqaE/Pmp3 family membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6962.13 Da Isoelectric Point: 12.1410
>T269246 WP_275627849.1 NZ_CP116775:c6100710-6100528 [Pseudomonas sp. 273]
MRSREIMELIRADGWFLVEVKGGHHQFRHFTKKGWVTVPHPRSNLPIGTVNSILRQAGLR
MRSREIMELIRADGWFLVEVKGGHHQFRHFTKKGWVTVPHPRSNLPIGTVNSILRQAGLR
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14604.30 Da Isoelectric Point: 4.4720
>AT269246 WP_275627848.1 NZ_CP116775:c6100496-6100092 [Pseudomonas sp. 273]
MKFPVVLHKDADSDYGVTIPDVPGCFSAGGTVSQALENVQEALALHFEGLVADDETLPQAQEVDTHMGNPDYAGGVWAVV
DFDVTPYLGKAVRFNATLPENLLQRIDERVKRDHRYASRSGFLATAALRELSSN
MKFPVVLHKDADSDYGVTIPDVPGCFSAGGTVSQALENVQEALALHFEGLVADDETLPQAQEVDTHMGNPDYAGGVWAVV
DFDVTPYLGKAVRFNATLPENLLQRIDERVKRDHRYASRSGFLATAALRELSSN
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|