Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 4532960..4533549 | Replicon | chromosome |
| Accession | NZ_CP116775 | ||
| Organism | Pseudomonas sp. 273 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | PKO50_RS20580 | Protein ID | WP_089391624.1 |
| Coordinates | 4533193..4533549 (+) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PKO50_RS20575 | Protein ID | WP_139210225.1 |
| Coordinates | 4532960..4533199 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PKO50_RS20550 | 4528196..4528819 | + | 624 | WP_275627095.1 | hypothetical protein | - |
| PKO50_RS20555 | 4528853..4529560 | + | 708 | WP_256595899.1 | peptidoglycan-binding domain-containing protein | - |
| PKO50_RS20560 | 4529575..4531200 | + | 1626 | WP_275627096.1 | hypothetical protein | - |
| PKO50_RS20565 | 4531281..4532117 | + | 837 | WP_275627097.1 | AraC family transcriptional regulator | - |
| PKO50_RS20570 | 4532169..4532774 | + | 606 | WP_275627098.1 | LysE family translocator | - |
| PKO50_RS20575 | 4532960..4533199 | + | 240 | WP_139210225.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PKO50_RS20580 | 4533193..4533549 | + | 357 | WP_089391624.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PKO50_RS20585 | 4533892..4534701 | - | 810 | WP_275627099.1 | class I SAM-dependent methyltransferase | - |
| PKO50_RS20590 | 4534793..4535386 | - | 594 | WP_275627100.1 | histidine phosphatase family protein | - |
| PKO50_RS20595 | 4535630..4536058 | - | 429 | WP_146219614.1 | hypothetical protein | - |
| PKO50_RS20600 | 4536479..4536832 | + | 354 | WP_275627101.1 | hypothetical protein | - |
| PKO50_RS20605 | 4536844..4537938 | - | 1095 | WP_275627102.1 | D-alanine--D-alanine ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13179.06 Da Isoelectric Point: 7.3242
>T269243 WP_089391624.1 NZ_CP116775:4533193-4533549 [Pseudomonas sp. 273]
MVRRPPSVPDRGEIWHLQFDPSTGREMIGDHFCLVLSKREFNEIGLALVCPISQGTSSVARNQGFLVTLMGEGTDTQGNV
HSHQVRTLDWRARRAMFKEKAPDSVTNYVLSLVGAILE
MVRRPPSVPDRGEIWHLQFDPSTGREMIGDHFCLVLSKREFNEIGLALVCPISQGTSSVARNQGFLVTLMGEGTDTQGNV
HSHQVRTLDWRARRAMFKEKAPDSVTNYVLSLVGAILE
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|