Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | slvAT/RES(toxin) |
| Location | 1964972..1965864 | Replicon | chromosome |
| Accession | NZ_CP116775 | ||
| Organism | Pseudomonas sp. 273 | ||
Toxin (Protein)
| Gene name | slvT | Uniprot ID | - |
| Locus tag | PKO50_RS09440 | Protein ID | WP_275629484.1 |
| Coordinates | 1965340..1965864 (+) | Length | 175 a.a. |
Antitoxin (Protein)
| Gene name | slvA | Uniprot ID | - |
| Locus tag | PKO50_RS09435 | Protein ID | WP_275629483.1 |
| Coordinates | 1964972..1965343 (+) | Length | 124 a.a. |
Genomic Context
Location: 1964972..1965343 (372 bp)
Type: Antitoxin
Protein ID: WP_275629483.1
Type: Antitoxin
Protein ID: WP_275629483.1
Location: 1965340..1965864 (525 bp)
Type: Toxin
Protein ID: WP_275629484.1
Type: Toxin
Protein ID: WP_275629484.1
Location: 1960127..1960897 (771 bp)
Type: Others
Protein ID: WP_275629478.1
Type: Others
Protein ID: WP_275629478.1
Location: 1960942..1962252 (1311 bp)
Type: Others
Protein ID: WP_275629479.1
Type: Others
Protein ID: WP_275629479.1
Location: 1962290..1962679 (390 bp)
Type: Others
Protein ID: WP_275629480.1
Type: Others
Protein ID: WP_275629480.1
Location: 1962679..1962891 (213 bp)
Type: Others
Protein ID: WP_275629481.1
Type: Others
Protein ID: WP_275629481.1
Location: 1962963..1963897 (935 bp)
Type: Others
Protein ID: Protein_1865
Type: Others
Protein ID: Protein_1865
Location: 1963897..1964217 (321 bp)
Type: Others
Protein ID: Protein_1866
Type: Others
Protein ID: Protein_1866
Location: 1964597..1964794 (198 bp)
Type: Others
Protein ID: WP_275629482.1
Type: Others
Protein ID: WP_275629482.1
Location: 1965878..1968739 (2862 bp)
Type: Others
Protein ID: WP_275629485.1
Type: Others
Protein ID: WP_275629485.1
Location: 1968739..1969173 (435 bp)
Type: Others
Protein ID: WP_275629486.1
Type: Others
Protein ID: WP_275629486.1
Location: 1969154..1970574 (1421 bp)
Type: Others
Protein ID: Protein_1872
Type: Others
Protein ID: Protein_1872
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PKO50_RS09400 | 1960127..1960897 | - | 771 | WP_275629478.1 | hypothetical protein | - |
| PKO50_RS09405 | 1960942..1962252 | - | 1311 | WP_275629479.1 | hypothetical protein | - |
| PKO50_RS09410 | 1962290..1962679 | - | 390 | WP_275629480.1 | type II toxin-antitoxin system VapC family toxin | - |
| PKO50_RS09415 | 1962679..1962891 | - | 213 | WP_275629481.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| PKO50_RS09420 | 1962963..1963897 | - | 935 | Protein_1865 | DUF3363 domain-containing protein | - |
| PKO50_RS09425 | 1963897..1964217 | - | 321 | Protein_1866 | Arm DNA-binding domain-containing protein | - |
| PKO50_RS09430 | 1964597..1964794 | - | 198 | WP_275629482.1 | hypothetical protein | - |
| PKO50_RS09435 | 1964972..1965343 | + | 372 | WP_275629483.1 | DUF2384 domain-containing protein | Antitoxin |
| PKO50_RS09440 | 1965340..1965864 | + | 525 | WP_275629484.1 | RES family NAD+ phosphorylase | Toxin |
| PKO50_RS09445 | 1965878..1968739 | - | 2862 | WP_275629485.1 | conjugative transfer ATPase | - |
| PKO50_RS09450 | 1968739..1969173 | - | 435 | WP_275629486.1 | TIGR03751 family conjugal transfer lipoprotein | - |
| PKO50_RS09455 | 1969154..1970574 | - | 1421 | Protein_1872 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1820837..2194583 | 373746 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19270.64 Da Isoelectric Point: 4.5023
>T269240 WP_275629484.1 NZ_CP116775:1965340-1965864 [Pseudomonas sp. 273]
MISKTLGADGDEAFYRVIVPAYAGTPLSGMGAARQGGRFNRPDQEALYLALDESTALAEYKQDNPWLRPGTICTFFINGL
RVADLSAGFDPDRWPPLWADYTVDWRAEWFDKSVEPPTWYMADDVVAAGLDGILFPSQARPGGTNLVIYHSSSRPAAQLR
VYDPDGALQRLINR
MISKTLGADGDEAFYRVIVPAYAGTPLSGMGAARQGGRFNRPDQEALYLALDESTALAEYKQDNPWLRPGTICTFFINGL
RVADLSAGFDPDRWPPLWADYTVDWRAEWFDKSVEPPTWYMADDVVAAGLDGILFPSQARPGGTNLVIYHSSSRPAAQLR
VYDPDGALQRLINR
Download Length: 525 bp
Antitoxin
Download Length: 124 a.a. Molecular weight: 13777.67 Da Isoelectric Point: 7.3173
>AT269240 WP_275629483.1 NZ_CP116775:1964972-1965343 [Pseudomonas sp. 273]
MNTVLQEPFVERFREPNTPYLSPSKVGDFFGFRVQELAERAHVHRNTPTARPQAPQLQKYLQDMVRVLAVATEMTGDVHR
AVFLLRNEPLRAFGYKTADTLIQEGRADAVIAYLESFAGGAAG
MNTVLQEPFVERFREPNTPYLSPSKVGDFFGFRVQELAERAHVHRNTPTARPQAPQLQKYLQDMVRVLAVATEMTGDVHR
AVFLLRNEPLRAFGYKTADTLIQEGRADAVIAYLESFAGGAAG
Download Length: 372 bp