Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 1237766..1238362 | Replicon | chromosome |
Accession | NZ_CP116775 | ||
Organism | Pseudomonas sp. 273 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | PKO50_RS06080 | Protein ID | WP_089393116.1 |
Coordinates | 1238021..1238362 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | - |
Locus tag | PKO50_RS06075 | Protein ID | WP_275629125.1 |
Coordinates | 1237766..1238014 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PKO50_RS06045 | 1232995..1233552 | - | 558 | WP_058072912.1 | glycine cleavage system protein R | - |
PKO50_RS06050 | 1233724..1234602 | + | 879 | WP_089393120.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
PKO50_RS06055 | 1234615..1235811 | + | 1197 | WP_089393119.1 | outer membrane protein assembly factor BamC | - |
PKO50_RS06060 | 1235750..1236508 | + | 759 | WP_089393118.1 | MBL fold metallo-hydrolase | - |
PKO50_RS06065 | 1236540..1237250 | + | 711 | WP_009620599.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PKO50_RS06075 | 1237766..1238014 | + | 249 | WP_275629125.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PKO50_RS06080 | 1238021..1238362 | + | 342 | WP_089393116.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PKO50_RS06085 | 1238440..1238736 | - | 297 | WP_275629126.1 | immunity protein Tsi6 family protein | - |
PKO50_RS06090 | 1238778..1238978 | - | 201 | WP_139210215.1 | hypothetical protein | - |
PKO50_RS06095 | 1239256..1240091 | - | 836 | Protein_1205 | 5'-nucleotidase, lipoprotein e(P4) family | - |
PKO50_RS06100 | 1240373..1241422 | + | 1050 | WP_275629127.1 | diguanylate cyclase | - |
PKO50_RS06105 | 1241410..1241781 | - | 372 | WP_275629128.1 | hypothetical protein | - |
PKO50_RS06110 | 1241857..1242198 | - | 342 | WP_089393110.1 | carboxymuconolactone decarboxylase family protein | - |
PKO50_RS06115 | 1242271..1242753 | - | 483 | WP_109936595.1 | GreA/GreB family elongation factor | - |
PKO50_RS06120 | 1242882..1243334 | + | 453 | WP_275629129.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1229633..1238993 | 9360 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12724.41 Da Isoelectric Point: 4.8991
>T269237 WP_089393116.1 NZ_CP116775:1238021-1238362 [Pseudomonas sp. 273]
MTGLDVRFTETAAFSLQDQEDHLAEHHAAETAAAKIDALIDTILTKLQAAPVGYPVSRQASDFGITRYRELNHDGYRVFY
EVFERDKAIAVELVLRQKQDVEAALIRYCLIGI
MTGLDVRFTETAAFSLQDQEDHLAEHHAAETAAAKIDALIDTILTKLQAAPVGYPVSRQASDFGITRYRELNHDGYRVFY
EVFERDKAIAVELVLRQKQDVEAALIRYCLIGI
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|