Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 695201..695856 | Replicon | chromosome |
| Accession | NZ_CP116775 | ||
| Organism | Pseudomonas sp. 273 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PKO50_RS03205 | Protein ID | WP_275628783.1 |
| Coordinates | 695677..695856 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PKO50_RS03200 | Protein ID | WP_109933682.1 |
| Coordinates | 695201..695629 (-) | Length | 143 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PKO50_RS03175 | 690494..691006 | - | 513 | WP_275628780.1 | RDD family protein | - |
| PKO50_RS03180 | 691175..692722 | + | 1548 | WP_275628781.1 | cyclic diguanylate phosphodiesterase | - |
| PKO50_RS03185 | 692790..693116 | - | 327 | WP_109933679.1 | hypothetical protein | - |
| PKO50_RS03190 | 693207..694652 | - | 1446 | WP_275628782.1 | SulP family inorganic anion transporter | - |
| PKO50_RS03195 | 694960..695196 | + | 237 | WP_109933681.1 | hypothetical protein | - |
| PKO50_RS03200 | 695201..695629 | - | 429 | WP_109933682.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PKO50_RS03205 | 695677..695856 | - | 180 | WP_275628783.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PKO50_RS03210 | 696453..697280 | + | 828 | WP_275628784.1 | site-specific integrase | - |
| PKO50_RS03215 | 697306..697611 | - | 306 | WP_275628785.1 | hypothetical protein | - |
| PKO50_RS03220 | 697608..698027 | - | 420 | WP_275628786.1 | hypothetical protein | - |
| PKO50_RS03225 | 698020..698757 | - | 738 | Protein_635 | hypothetical protein | - |
| PKO50_RS03230 | 698754..699071 | - | 318 | WP_275628787.1 | hypothetical protein | - |
| PKO50_RS03235 | 699068..699493 | - | 426 | WP_275628788.1 | hypothetical protein | - |
| PKO50_RS03240 | 699493..699696 | - | 204 | WP_275628789.1 | hypothetical protein | - |
| PKO50_RS03245 | 699693..699917 | - | 225 | WP_275628790.1 | hypothetical protein | - |
| PKO50_RS03250 | 699914..700438 | - | 525 | WP_275628791.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 695201..739114 | 43913 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6631.64 Da Isoelectric Point: 11.3463
>T269236 WP_275628783.1 NZ_CP116775:c695856-695677 [Pseudomonas sp. 273]
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGRTTTFADHGAREMPEPTRKAIIKQPGL
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGRTTTFADHGAREMPEPTRKAIIKQPGL
Download Length: 180 bp
Antitoxin
Download Length: 143 a.a. Molecular weight: 15706.93 Da Isoelectric Point: 4.6733
>AT269236 WP_109933682.1 NZ_CP116775:c695629-695201 [Pseudomonas sp. 273]
MYDYPIRFEQDDSAPGIAVFCRDLPELNSFGDDRDHAIREALDAIETTLSLYVDERRAIPAASAPEAGEHVVHLPAVTVA
KIALWNEMMQRGMRKADLCRLLGVAQTQGDRLVDFLHTSKMDQLELALGALGKRLSITVEAA
MYDYPIRFEQDDSAPGIAVFCRDLPELNSFGDDRDHAIREALDAIETTLSLYVDERRAIPAASAPEAGEHVVHLPAVTVA
KIALWNEMMQRGMRKADLCRLLGVAQTQGDRLVDFLHTSKMDQLELALGALGKRLSITVEAA
Download Length: 429 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|