Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 147695..148362 | Replicon | chromosome |
Accession | NZ_CP116775 | ||
Organism | Pseudomonas sp. 273 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | - |
Locus tag | PKO50_RS00695 | Protein ID | WP_275628534.1 |
Coordinates | 147695..148105 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | - |
Locus tag | PKO50_RS00700 | Protein ID | WP_089390172.1 |
Coordinates | 148102..148362 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PKO50_RS00675 | 143834..144367 | + | 534 | WP_089390167.1 | (2Fe-2S)-binding protein | - |
PKO50_RS00680 | 144370..145611 | + | 1242 | WP_275628531.1 | cytochrome c | - |
PKO50_RS00685 | 145613..146581 | + | 969 | WP_275628532.1 | XdhC family protein | - |
PKO50_RS00690 | 146578..147153 | + | 576 | WP_275628533.1 | nucleotidyltransferase family protein | - |
PKO50_RS00695 | 147695..148105 | - | 411 | WP_275628534.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PKO50_RS00700 | 148102..148362 | - | 261 | WP_089390172.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PKO50_RS00705 | 148447..149571 | - | 1125 | WP_275628535.1 | class I SAM-dependent methyltransferase | - |
PKO50_RS00710 | 149699..150475 | + | 777 | WP_089390174.1 | ferredoxin--NADP reductase | - |
PKO50_RS00715 | 150664..152217 | + | 1554 | WP_275628536.1 | TerC family protein | - |
PKO50_RS00720 | 152236..152649 | - | 414 | WP_089390176.1 | large-conductance mechanosensitive channel protein MscL | - |
PKO50_RS00725 | 152840..153082 | + | 243 | WP_089390177.1 | YdcH family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15349.74 Da Isoelectric Point: 8.2695
>T269234 WP_275628534.1 NZ_CP116775:c148105-147695 [Pseudomonas sp. 273]
VKYLLDTNILIYLLKNRPESVARRVNALPADAGLCMSFITYAELLKGAERSTRRGEVLRQLERLTRQVPVVYDGTPRLCE
HYAAQFTRLKLAGTPIGANGLWIACHALALEATLVTHNTREFERIDGLRLEDWAAE
VKYLLDTNILIYLLKNRPESVARRVNALPADAGLCMSFITYAELLKGAERSTRRGEVLRQLERLTRQVPVVYDGTPRLCE
HYAAQFTRLKLAGTPIGANGLWIACHALALEATLVTHNTREFERIDGLRLEDWAAE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|