Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 122952..123526 | Replicon | chromosome |
Accession | NZ_CP116775 | ||
Organism | Pseudomonas sp. 273 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PKO50_RS00585 | Protein ID | WP_275628519.1 |
Coordinates | 123161..123526 (+) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PKO50_RS00580 | Protein ID | WP_089390284.1 |
Coordinates | 122952..123167 (+) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PKO50_RS00560 | 117963..118754 | + | 792 | WP_275628516.1 | taurine ABC transporter ATP-binding protein | - |
PKO50_RS00565 | 118744..119561 | + | 818 | Protein_111 | taurine ABC transporter permease TauC | - |
PKO50_RS00570 | 119743..120579 | + | 837 | WP_275628517.1 | taurine dioxygenase | - |
PKO50_RS00575 | 120859..122883 | + | 2025 | WP_275628518.1 | oligopeptide transporter, OPT family | - |
PKO50_RS00580 | 122952..123167 | + | 216 | WP_089390284.1 | CopG family transcriptional regulator | Antitoxin |
PKO50_RS00585 | 123161..123526 | + | 366 | WP_275628519.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PKO50_RS00590 | 123514..124239 | - | 726 | WP_275628520.1 | hypothetical protein | - |
PKO50_RS00595 | 124236..124418 | - | 183 | WP_275628521.1 | hypothetical protein | - |
PKO50_RS00600 | 124415..125563 | - | 1149 | WP_275628522.1 | PepSY domain-containing protein | - |
PKO50_RS00605 | 125571..127984 | - | 2414 | Protein_119 | TonB-dependent receptor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13329.35 Da Isoelectric Point: 5.7101
>T269233 WP_275628519.1 NZ_CP116775:123161-123526 [Pseudomonas sp. 273]
MVKALFDTNILIDYLNGHEQARDELRRHDDPAISIVTWMEVMIGATPATAAATRAFLDSFALVPLDASVAERAVAVRQTL
RVKLPDAIIKASAEVQGRLLVSRNTRDFPVDDVGVRLPYSL
MVKALFDTNILIDYLNGHEQARDELRRHDDPAISIVTWMEVMIGATPATAAATRAFLDSFALVPLDASVAERAVAVRQTL
RVKLPDAIIKASAEVQGRLLVSRNTRDFPVDDVGVRLPYSL
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|