Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3239261..3239897 | Replicon | chromosome |
Accession | NZ_CP116774 | ||
Organism | Bacillus safensis strain SRCM125915 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A0P7G713 |
Locus tag | PNF30_RS16715 | Protein ID | WP_024425388.1 |
Coordinates | 3239261..3239611 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | W8QJ31 |
Locus tag | PNF30_RS16720 | Protein ID | WP_003214273.1 |
Coordinates | 3239616..3239897 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PNF30_RS16675 (PNF30_16675) | 3234291..3234890 | - | 600 | WP_205183263.1 | PP2C family serine/threonine-protein phosphatase | - |
PNF30_RS16680 (PNF30_16680) | 3234890..3235678 | - | 789 | WP_024427378.1 | RNA polymerase sigma factor SigB | - |
PNF30_RS16685 (PNF30_16685) | 3235644..3236132 | - | 489 | WP_048240335.1 | anti-sigma B factor RsbW | - |
PNF30_RS16690 (PNF30_16690) | 3236129..3236458 | - | 330 | WP_017358393.1 | anti-sigma factor antagonist | - |
PNF30_RS16695 (PNF30_16695) | 3236518..3237525 | - | 1008 | WP_095407804.1 | PP2C family protein-serine/threonine phosphatase | - |
PNF30_RS16700 (PNF30_16700) | 3237536..3237937 | - | 402 | WP_024427376.1 | anti-sigma regulatory factor | - |
PNF30_RS16705 (PNF30_16705) | 3237940..3238308 | - | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
PNF30_RS16710 (PNF30_16710) | 3238313..3239143 | - | 831 | WP_272510456.1 | RsbT co-antagonist protein RsbRA | - |
PNF30_RS16715 (PNF30_16715) | 3239261..3239611 | - | 351 | WP_024425388.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PNF30_RS16720 (PNF30_16720) | 3239616..3239897 | - | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
PNF30_RS16725 (PNF30_16725) | 3240191..3241357 | - | 1167 | WP_272510457.1 | alanine racemase | - |
PNF30_RS16730 (PNF30_16730) | 3241497..3242513 | - | 1017 | WP_095407802.1 | outer membrane lipoprotein carrier protein LolA | - |
PNF30_RS16735 (PNF30_16735) | 3242674..3243039 | - | 366 | WP_272510458.1 | holo-ACP synthase | - |
PNF30_RS16740 (PNF30_16740) | 3243134..3243739 | + | 606 | WP_144472946.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8891
>T269232 WP_024425388.1 NZ_CP116774:c3239611-3239261 [Bacillus safensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P7G713 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A081L854 |