Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3542030..3542666 | Replicon | chromosome |
Accession | NZ_CP116773 | ||
Organism | Bacillus subtilis strain SRCM125727 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PNF29_RS18800 | Protein ID | WP_003156187.1 |
Coordinates | 3542030..3542380 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | PNF29_RS18805 | Protein ID | WP_003225183.1 |
Coordinates | 3542385..3542666 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PNF29_RS18760 (PNF29_18760) | 3537074..3537673 | - | 600 | WP_017696999.1 | phosphoserine phosphatase RsbX | - |
PNF29_RS18765 (PNF29_18765) | 3537673..3538461 | - | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
PNF29_RS18770 (PNF29_18770) | 3538427..3538909 | - | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
PNF29_RS18775 (PNF29_18775) | 3538906..3539235 | - | 330 | WP_014662855.1 | anti-sigma factor antagonist RsbV | - |
PNF29_RS18780 (PNF29_18780) | 3539297..3540304 | - | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
PNF29_RS18785 (PNF29_18785) | 3540316..3540717 | - | 402 | WP_017697001.1 | serine/threonine-protein kinase RsbT | - |
PNF29_RS18790 (PNF29_18790) | 3540721..3541086 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
PNF29_RS18795 (PNF29_18795) | 3541091..3541915 | - | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
PNF29_RS18800 (PNF29_18800) | 3542030..3542380 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PNF29_RS18805 (PNF29_18805) | 3542385..3542666 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PNF29_RS18810 (PNF29_18810) | 3542782..3543951 | - | 1170 | WP_017697002.1 | alanine racemase | - |
PNF29_RS18815 (PNF29_18815) | 3544065..3545081 | - | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
PNF29_RS18820 (PNF29_18820) | 3545247..3545612 | - | 366 | WP_014475874.1 | holo-ACP synthase | - |
PNF29_RS18825 (PNF29_18825) | 3545707..3546306 | + | 600 | WP_041351790.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T269231 WP_003156187.1 NZ_CP116773:c3542380-3542030 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|