Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 2691337..2692253 | Replicon | chromosome |
Accession | NZ_CP116773 | ||
Organism | Bacillus subtilis strain SRCM125727 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | PNF29_RS14260 | Protein ID | WP_003244695.1 |
Coordinates | 2691337..2692083 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | PNF29_RS14265 | Protein ID | WP_003232646.1 |
Coordinates | 2692083..2692253 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PNF29_RS14235 (PNF29_14235) | 2686455..2686556 | - | 102 | Protein_2809 | hypothetical protein | - |
PNF29_RS14240 (PNF29_14240) | 2686665..2687615 | - | 951 | WP_014476561.1 | ring-cleaving dioxygenase | - |
PNF29_RS14245 (PNF29_14245) | 2688004..2689320 | + | 1317 | WP_272515589.1 | serine/threonine exchanger | - |
PNF29_RS14250 (PNF29_14250) | 2689596..2690213 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
PNF29_RS14255 (PNF29_14255) | 2690226..2691227 | + | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
PNF29_RS14260 (PNF29_14260) | 2691337..2692083 | + | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
PNF29_RS14265 (PNF29_14265) | 2692083..2692253 | + | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
PNF29_RS14270 (PNF29_14270) | 2692339..2692476 | + | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
PNF29_RS14275 (PNF29_14275) | 2692514..2693407 | - | 894 | WP_041333865.1 | N-acetylmuramoyl-L-alanine amidase | - |
PNF29_RS14280 (PNF29_14280) | 2693420..2693683 | - | 264 | WP_003232653.1 | phage holin | - |
PNF29_RS14285 (PNF29_14285) | 2693696..2693965 | - | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
PNF29_RS14290 (PNF29_14290) | 2694018..2694857 | - | 840 | WP_128473844.1 | phage-like element PBSX protein XepA | - |
PNF29_RS14295 (PNF29_14295) | 2694901..2695065 | - | 165 | WP_087960875.1 | XkdX family protein | - |
PNF29_RS14300 (PNF29_14300) | 2695062..2695391 | - | 330 | WP_003232660.1 | XkdW family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T269230 WP_003244695.1 NZ_CP116773:2691337-2692083 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|