Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yoeB-relE/YoeB-RelB |
| Location | 2778214..2778725 | Replicon | chromosome |
| Accession | NZ_CP116770 | ||
| Organism | Brevundimonas sp. 2003-09-23 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | PIB44_RS13650 | Protein ID | WP_227157471.1 |
| Coordinates | 2778465..2778725 (+) | Length | 87 a.a. |
Antitoxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PIB44_RS13645 | Protein ID | WP_278069776.1 |
| Coordinates | 2778214..2778468 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB44_RS13625 | 2773939..2774352 | + | 414 | WP_025977731.1 | DoxX family protein | - |
| PIB44_RS13630 | 2774533..2775021 | + | 489 | WP_025977732.1 | MerR family DNA-binding transcriptional regulator | - |
| PIB44_RS13635 | 2775026..2776807 | + | 1782 | WP_278069774.1 | acyl-CoA dehydrogenase C-terminal domain-containing protein | - |
| PIB44_RS13640 | 2777009..2778172 | + | 1164 | WP_278069775.1 | acyl-CoA dehydrogenase family protein | - |
| PIB44_RS13645 | 2778214..2778468 | + | 255 | WP_278069776.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| PIB44_RS13650 | 2778465..2778725 | + | 261 | WP_227157471.1 | Txe/YoeB family addiction module toxin | Toxin |
| PIB44_RS13655 | 2778732..2780246 | - | 1515 | WP_278069777.1 | AarF/UbiB family protein | - |
| PIB44_RS13660 | 2780341..2781060 | + | 720 | WP_278069778.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| PIB44_RS13665 | 2781130..2782491 | + | 1362 | WP_278069779.1 | glutamate--cysteine ligase | - |
| PIB44_RS13670 | 2782488..2783282 | - | 795 | WP_278069780.1 | TSUP family transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10368.76 Da Isoelectric Point: 9.0274
>T269229 WP_227157471.1 NZ_CP116770:2778465-2778725 [Brevundimonas sp. 2003-09-23]
MKLTFQEEGWEDYLYWQSADRKQLKKINGLIRECLRTPFSGTGKPEPLKGEFSGWWSRRIDQEHRLVYRATDDTLLIAQC
RYHYGR
MKLTFQEEGWEDYLYWQSADRKQLKKINGLIRECLRTPFSGTGKPEPLKGEFSGWWSRRIDQEHRLVYRATDDTLLIAQC
RYHYGR
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|