Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF-MazE |
| Location | 1717265..1717848 | Replicon | chromosome |
| Accession | NZ_CP116766 | ||
| Organism | Neisseria sp. ZJ106 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PJU73_RS07925 | Protein ID | WP_237090730.1 |
| Coordinates | 1717265..1717606 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PJU73_RS07930 | Protein ID | WP_237090729.1 |
| Coordinates | 1717606..1717848 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJU73_RS07905 (PJU73_07905) | 1712774..1713640 | - | 867 | WP_237090734.1 | ribosome small subunit-dependent GTPase A | - |
| PJU73_RS07910 (PJU73_07910) | 1713779..1714153 | + | 375 | WP_237090733.1 | hypothetical protein | - |
| PJU73_RS07915 (PJU73_07915) | 1714300..1715670 | - | 1371 | WP_237090732.1 | adenylosuccinate lyase | - |
| PJU73_RS07920 (PJU73_07920) | 1716028..1717131 | - | 1104 | WP_237090731.1 | peptide chain release factor 2 | - |
| PJU73_RS07925 (PJU73_07925) | 1717265..1717606 | - | 342 | WP_237090730.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PJU73_RS07930 (PJU73_07930) | 1717606..1717848 | - | 243 | WP_237090729.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PJU73_RS07935 (PJU73_07935) | 1718097..1719878 | + | 1782 | WP_237090728.1 | cation:proton antiporter | - |
| PJU73_RS07940 (PJU73_07940) | 1720149..1721369 | + | 1221 | WP_237090727.1 | serine/threonine transporter SstT | - |
| PJU73_RS07945 (PJU73_07945) | 1721486..1721920 | - | 435 | WP_237090726.1 | Lrp/AsnC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12515.60 Da Isoelectric Point: 8.5222
>T269227 WP_237090730.1 NZ_CP116766:c1717606-1717265 [Neisseria sp. ZJ106]
MYIPDKGDIIHLQFDPASGREMKGNHFALVLSSKAFNQKIGLVFACPISQGKADTARGMLSTLLGAGTVLQGNIHCHQLK
SLDWKERRAVLKEKVPDYVLQDVLSRIEAILEL
MYIPDKGDIIHLQFDPASGREMKGNHFALVLSSKAFNQKIGLVFACPISQGKADTARGMLSTLLGAGTVLQGNIHCHQLK
SLDWKERRAVLKEKVPDYVLQDVLSRIEAILEL
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|