Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
Location | 4713..5314 | Replicon | plasmid pMWLp-12E |
Accession | NZ_CP116754 | ||
Organism | Lactiplantibacillus plantarum strain MWLp-12 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | Q684P1 |
Locus tag | MWLp12_RS16015 | Protein ID | WP_001748110.1 |
Coordinates | 4970..5314 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | MWLp12_RS16010 | Protein ID | WP_272524910.1 |
Coordinates | 4713..4976 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MWLp12_RS15990 (MWLp12_pE0001) | 93..617 | + | 525 | WP_003646143.1 | hypothetical protein | - |
MWLp12_RS15995 (MWLp12_pE0002) | 1603..1899 | + | 297 | WP_146708724.1 | hypothetical protein | - |
MWLp12_RS16005 (MWLp12_pE0005) | 4040..4627 | - | 588 | WP_025016518.1 | site-specific integrase | - |
MWLp12_RS16010 (MWLp12_pE0006) | 4713..4976 | + | 264 | WP_272524910.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
MWLp12_RS16015 (MWLp12_pE0007) | 4970..5314 | + | 345 | WP_001748110.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MWLp12_RS16020 (MWLp12_pE0008) | 5636..6565 | + | 930 | WP_272524911.1 | IS30-like element ISLpl1 family transposase | - |
MWLp12_RS16025 (MWLp12_pE0009) | 6665..7033 | + | 369 | WP_272524912.1 | hypothetical protein | - |
MWLp12_RS16030 (MWLp12_pE0010) | 7156..7356 | + | 201 | WP_003643340.1 | cold-shock protein | - |
MWLp12_RS16035 (MWLp12_pE0011) | 7443..7685 | + | 243 | WP_003643341.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..8184 | 8184 | |
- | flank | IS/Tn | - | - | 5636..6565 | 929 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13041.89 Da Isoelectric Point: 6.4782
>T269224 WP_001748110.1 NZ_CP116754:4970-5314 [Lactiplantibacillus plantarum]
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|