Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 482072..482616 | Replicon | chromosome |
Accession | NZ_CP116735 | ||
Organism | Agrobacterium pusense strain CFBP5496 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A7W4TSM3 |
Locus tag | CFBP5496_RS02405 | Protein ID | WP_072494055.1 |
Coordinates | 482326..482616 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | CFBP5496_RS02400 | Protein ID | WP_107341193.1 |
Coordinates | 482072..482323 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP5496_RS02375 (CFBP5496_0002375) | 477170..477859 | - | 690 | WP_037090773.1 | HAD family hydrolase | - |
CFBP5496_RS02380 (CFBP5496_0002380) | 478074..478754 | + | 681 | WP_004440402.1 | GntR family transcriptional regulator | - |
CFBP5496_RS02385 (CFBP5496_0002385) | 478795..479256 | + | 462 | WP_072494876.1 | DUF1284 domain-containing protein | - |
CFBP5496_RS02390 (CFBP5496_0002390) | 479216..480316 | - | 1101 | WP_136882482.1 | hypothetical protein | - |
CFBP5496_RS02395 (CFBP5496_0002395) | 480553..481698 | + | 1146 | WP_004440405.1 | site-specific DNA-methyltransferase | - |
CFBP5496_RS02400 (CFBP5496_0002400) | 482072..482323 | + | 252 | WP_107341193.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
CFBP5496_RS02405 (CFBP5496_0002405) | 482326..482616 | + | 291 | WP_072494055.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP5496_RS02410 (CFBP5496_0002410) | 482648..483259 | - | 612 | WP_022555751.1 | HAD family phosphatase | - |
CFBP5496_RS02415 (CFBP5496_0002415) | 483342..484451 | - | 1110 | WP_052114204.1 | A/G-specific adenine glycosylase | - |
CFBP5496_RS02420 (CFBP5496_0002420) | 484364..484600 | + | 237 | WP_162484560.1 | hypothetical protein | - |
CFBP5496_RS02425 (CFBP5496_0002425) | 484578..485042 | + | 465 | WP_034495929.1 | hypothetical protein | - |
CFBP5496_RS02430 (CFBP5496_0002430) | 485070..485591 | + | 522 | WP_037090771.1 | DUF721 domain-containing protein | - |
CFBP5496_RS02435 (CFBP5496_0002435) | 485720..486400 | + | 681 | WP_037090769.1 | DsbA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11196.72 Da Isoelectric Point: 6.6456
>T269221 WP_072494055.1 NZ_CP116735:482326-482616 [Agrobacterium pusense]
MGFRLSLPAEEDVIRIAQEGIDLFGPQQARKYHRELFAIFDLISRNPRIARERGELSPSVRIHPFRAHLVVYRVEADDDV
LIVRVRHGHEDWGNEP
MGFRLSLPAEEDVIRIAQEGIDLFGPQQARKYHRELFAIFDLISRNPRIARERGELSPSVRIHPFRAHLVVYRVEADDDV
LIVRVRHGHEDWGNEP
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|