Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 362577..363057 Replicon chromosome
Accession NZ_CP116735
Organism Agrobacterium pusense strain CFBP5496

Toxin (Protein)


Gene name pasB Uniprot ID -
Locus tag CFBP5496_RS01805 Protein ID WP_107339071.1
Coordinates 362577..362846 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID -
Locus tag CFBP5496_RS01810 Protein ID WP_107339072.1
Coordinates 362830..363057 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CFBP5496_RS01770 (CFBP5496_0001770) 357677..358306 + 630 WP_037090940.1 DNA-3-methyladenine glycosylase I -
CFBP5496_RS01775 (CFBP5496_0001775) 358303..358746 + 444 WP_004440178.1 hypothetical protein -
CFBP5496_RS01780 (CFBP5496_0001780) 358761..359804 - 1044 WP_037090837.1 YeiH family protein -
CFBP5496_RS01785 (CFBP5496_0001785) 359886..360803 + 918 WP_004440182.1 LysR substrate-binding domain-containing protein -
CFBP5496_RS01790 (CFBP5496_0001790) 360949..361323 - 375 WP_037090836.1 DUF305 domain-containing protein -
CFBP5496_RS01795 (CFBP5496_0001795) 361381..361764 - 384 WP_234882025.1 hypothetical protein -
CFBP5496_RS01800 (CFBP5496_0001800) 361806..362570 - 765 WP_035211489.1 hypothetical protein -
CFBP5496_RS01805 (CFBP5496_0001805) 362577..362846 - 270 WP_107339071.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
CFBP5496_RS01810 (CFBP5496_0001810) 362830..363057 - 228 WP_107339072.1 DUF6290 family protein Antitoxin
CFBP5496_RS01815 (CFBP5496_0001815) 363292..364815 + 1524 WP_136882471.1 histidine--tRNA ligase -
CFBP5496_RS01820 (CFBP5496_0001820) 364820..365188 + 369 WP_006699502.1 VOC family protein -
CFBP5496_RS01825 (CFBP5496_0001825) 365205..366329 + 1125 WP_004440189.1 ATP phosphoribosyltransferase regulatory subunit -
CFBP5496_RS01830 (CFBP5496_0001830) 366326..367018 + 693 WP_004440190.1 ATP phosphoribosyltransferase -
CFBP5496_RS01835 (CFBP5496_0001835) 367081..367527 - 447 WP_037090832.1 DoxX family protein -
CFBP5496_RS01840 (CFBP5496_0001840) 367675..368025 - 351 WP_234823690.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-88)

Antitoxin

Protein of unknown function DUF6290

(6-73)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10611.20 Da        Isoelectric Point: 9.4763

>T269220 WP_107339071.1 NZ_CP116735:c362846-362577 [Agrobacterium pusense]
VIWTIEYDSLVQKEMRKIDPQARQRIRAFLQERVAALDNPRQTGAALQGSELGNYWRYRVGDYRIICDIQDHKLIVLVVE
IGHRREIYR

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8923.95 Da        Isoelectric Point: 4.7254

>AT269220 WP_107339072.1 NZ_CP116735:c363057-362830 [Agrobacterium pusense]
MSKQTAIRLPDETYERLKALSERTGRTSAYYIREAIEKHIEDMEDLYLAEEATRRLQRGESKVISAEEFWRDLDN

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References