Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 400958..401748 | Replicon | plasmid pAtFPH-AT4a |
Accession | NZ_CP116732 | ||
Organism | Agrobacterium fabacearum strain FPH-AT4 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1S7NFF1 |
Locus tag | G6L23_RS24850 | Protein ID | WP_019565755.1 |
Coordinates | 401251..401748 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A1S7NER6 |
Locus tag | G6L23_RS24845 | Protein ID | WP_019565754.1 |
Coordinates | 400958..401254 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L23_RS24825 (G6L23_024825) | 396326..398050 | + | 1725 | WP_013637436.1 | ABC transporter ATP-binding protein | - |
G6L23_RS24830 (G6L23_024830) | 398095..399282 | + | 1188 | WP_145166916.1 | galactarate dehydratase | - |
G6L23_RS24835 (G6L23_024835) | 399269..400135 | + | 867 | WP_174048019.1 | aldose 1-epimerase | - |
G6L23_RS24840 (G6L23_024840) | 400345..400775 | + | 431 | Protein_410 | DDE-type integrase/transposase/recombinase | - |
G6L23_RS24845 (G6L23_024845) | 400958..401254 | + | 297 | WP_019565754.1 | DUF1778 domain-containing protein | Antitoxin |
G6L23_RS24850 (G6L23_024850) | 401251..401748 | + | 498 | WP_019565755.1 | GNAT family N-acetyltransferase | Toxin |
G6L23_RS24855 (G6L23_024855) | 402367..402915 | + | 549 | WP_019565757.1 | TRAP transporter small permease subunit | - |
G6L23_RS24860 (G6L23_024860) | 402933..404438 | + | 1506 | WP_174047949.1 | TRAP transporter large permease subunit | - |
G6L23_RS24865 (G6L23_024865) | 404502..405614 | + | 1113 | WP_065703185.1 | TRAP transporter substrate-binding protein | - |
G6L23_RS24870 (G6L23_024870) | 405678..406310 | - | 633 | WP_019565760.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..735041 | 735041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17725.27 Da Isoelectric Point: 6.8629
>T269219 WP_019565755.1 NZ_CP116732:401251-401748 [Agrobacterium fabacearum]
VTLSAPVPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALASGSVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNT
VTLSAPVPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALASGSVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNT
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S7NFF1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S7NER6 |