Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 388352..389022 | Replicon | plasmid pAtFPH-AT4a |
Accession | NZ_CP116732 | ||
Organism | Agrobacterium fabacearum strain FPH-AT4 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | G6L23_RS24790 | Protein ID | WP_145166913.1 |
Coordinates | 388603..389022 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | F0LGD9 |
Locus tag | G6L23_RS24785 | Protein ID | WP_003517203.1 |
Coordinates | 388352..388606 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L23_RS24775 (G6L23_024775) | 385820..386827 | + | 1008 | WP_019565741.1 | sensor histidine kinase | - |
G6L23_RS24780 (G6L23_024780) | 387363..387968 | - | 606 | WP_174048018.1 | J domain-containing protein | - |
G6L23_RS24785 (G6L23_024785) | 388352..388606 | + | 255 | WP_003517203.1 | plasmid stabilization protein | Antitoxin |
G6L23_RS24790 (G6L23_024790) | 388603..389022 | + | 420 | WP_145166913.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
G6L23_RS24795 (G6L23_024795) | 389242..390138 | - | 897 | WP_013637432.1 | dihydrodipicolinate synthase family protein | - |
G6L23_RS24800 (G6L23_024800) | 390171..391052 | - | 882 | WP_111783761.1 | SMP-30/gluconolactonase/LRE family protein | - |
G6L23_RS24805 (G6L23_024805) | 391109..391828 | - | 720 | WP_003517195.1 | FCD domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..735041 | 735041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15040.21 Da Isoelectric Point: 5.1532
>T269218 WP_145166913.1 NZ_CP116732:388603-389022 [Agrobacterium fabacearum]
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARTRASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINAWSR
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARTRASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINAWSR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|