Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 280242..280822 Replicon plasmid pAtFPH-AT4a
Accession NZ_CP116732
Organism Agrobacterium fabacearum strain FPH-AT4

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag G6L23_RS24240 Protein ID WP_174047889.1
Coordinates 280242..280625 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID F0LFX8
Locus tag G6L23_RS24245 Protein ID WP_013637280.1
Coordinates 280622..280822 (-) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G6L23_RS24215 (G6L23_024215) 276698..277309 + 612 WP_174047886.1 AbiEi antitoxin N-terminal domain-containing protein -
G6L23_RS24220 (G6L23_024220) 277302..277841 + 540 WP_236772775.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
G6L23_RS24225 (G6L23_024225) 278061..278255 - 195 WP_236772776.1 hypothetical protein -
G6L23_RS24230 (G6L23_024230) 278288..278829 - 542 Protein_288 IS6 family transposase -
G6L23_RS24235 (G6L23_024235) 278933..279829 - 897 WP_174047888.1 transglutaminase family protein -
G6L23_RS24240 (G6L23_024240) 280242..280625 - 384 WP_174047889.1 type II toxin-antitoxin system VapC family toxin Toxin
G6L23_RS24245 (G6L23_024245) 280622..280822 - 201 WP_013637280.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
G6L23_RS24250 (G6L23_024250) 281115..281918 - 804 WP_174047890.1 helix-turn-helix transcriptional regulator -
G6L23_RS24255 (G6L23_024255) 281993..282934 + 942 WP_174047891.1 NmrA family NAD(P)-binding protein -
G6L23_RS24260 (G6L23_024260) 283124..284155 - 1032 WP_174047892.1 ankyrin repeat domain-containing protein -
G6L23_RS24265 (G6L23_024265) 284177..285187 - 1011 WP_174047893.1 alpha/beta hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..735041 735041


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-112)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14271.31 Da        Isoelectric Point: 6.6030

>T269217 WP_174047889.1 NZ_CP116732:c280625-280242 [Agrobacterium fabacearum]
VILVDTSIWIDHFRYDDSELRKIINDDQLLCHPFVVGELALGSLRERAAVLEFLAAQREALIATHAEVMTFIDRHSIFSM
GIGYTDAHLLTSTLLDRRSSLWTRDKRLSAAAQKVGAALYPHAQASH

Download         Length: 384 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7197.28 Da        Isoelectric Point: 10.7407

>AT269217 WP_013637280.1 NZ_CP116732:c280822-280622 [Agrobacterium fabacearum]
MRSTINIDDNLMERAKSLTGTKETAALVRQALETLVRVESGKRLIALGGSMPEAEASPRRRSDVAK

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB F0LFX8

References