Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 266981..267528 | Replicon | plasmid pAtFPH-AT4a |
| Accession | NZ_CP116732 | ||
| Organism | Agrobacterium fabacearum strain FPH-AT4 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | G6L23_RS24180 | Protein ID | WP_174047880.1 |
| Coordinates | 267235..267528 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | G6L23_RS24175 | Protein ID | WP_174047879.1 |
| Coordinates | 266981..267235 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L23_RS24145 (G6L23_024145) | 262169..263491 | - | 1323 | WP_174047876.1 | type II toxin-antitoxin system HipA family toxin | - |
| G6L23_RS24150 (G6L23_024150) | 263481..263765 | - | 285 | WP_020811813.1 | helix-turn-helix transcriptional regulator | - |
| G6L23_RS24155 (G6L23_024155) | 264186..264943 | + | 758 | WP_174047877.1 | IS5 family transposase | - |
| G6L23_RS24160 (G6L23_024160) | 264944..265390 | - | 447 | WP_272479408.1 | LysR substrate-binding domain-containing protein | - |
| G6L23_RS24165 (G6L23_024165) | 265753..266016 | + | 264 | WP_174047905.1 | hypothetical protein | - |
| G6L23_RS24170 (G6L23_024170) | 266134..266724 | + | 591 | WP_236772774.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| G6L23_RS24175 (G6L23_024175) | 266981..267235 | + | 255 | WP_174047879.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| G6L23_RS24180 (G6L23_024180) | 267235..267528 | + | 294 | WP_174047880.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| G6L23_RS24185 (G6L23_024185) | 267653..268720 | - | 1068 | WP_174047881.1 | AI-2E family transporter | - |
| G6L23_RS24190 (G6L23_024190) | 268931..269848 | - | 918 | WP_174047882.1 | carbamate kinase | - |
| G6L23_RS24195 (G6L23_024195) | 269852..270853 | - | 1002 | WP_174047883.1 | ornithine carbamoyltransferase | - |
| G6L23_RS24200 (G6L23_024200) | 270871..272103 | - | 1233 | WP_174047884.1 | arginine deiminase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..735041 | 735041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11032.63 Da Isoelectric Point: 5.9691
>T269215 WP_174047880.1 NZ_CP116732:267235-267528 [Agrobacterium fabacearum]
MPFSLSVQAEEDIISIAEEGIRIFGALVARQYHDELFALLALIATNPRIARERHEISPPVRIHPFKAHPVVYRIIEDGSV
FVIRIRNGHEDWAGDSF
MPFSLSVQAEEDIISIAEEGIRIFGALVARQYHDELFALLALIATNPRIARERHEISPPVRIHPFKAHPVVYRIIEDGSV
FVIRIRNGHEDWAGDSF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|