Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) chpB-mazE/PRK09812-ChpS
Location 117115..117710 Replicon plasmid unnamed1
Accession NZ_CP116726
Organism Pseudomonas aeruginosa strain 2881

Toxin (Protein)


Gene name chpB Uniprot ID A0A2K4Y2Z0
Locus tag PMJ88_RS33945 Protein ID WP_023100676.1
Coordinates 117115..117465 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag PMJ88_RS33950 Protein ID WP_034017785.1
Coordinates 117462..117710 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PMJ88_RS33910 (PMJ88_33910) 112817..113308 + 492 WP_023100670.1 hypothetical protein -
PMJ88_RS33915 (PMJ88_33915) 113540..114283 + 744 WP_023100671.1 glyoxalase superfamily protein -
PMJ88_RS33920 (PMJ88_33920) 114607..114870 + 264 WP_020303033.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
PMJ88_RS33925 (PMJ88_33925) 114857..115138 + 282 WP_023100672.1 type II toxin-antitoxin system YafQ family toxin -
PMJ88_RS33930 (PMJ88_33930) 115175..115510 + 336 WP_023100673.1 hypothetical protein -
PMJ88_RS33935 (PMJ88_33935) 115892..116344 + 453 WP_023100674.1 hypothetical protein -
PMJ88_RS33940 (PMJ88_33940) 116393..117115 - 723 WP_031634065.1 hypothetical protein -
PMJ88_RS33945 (PMJ88_33945) 117115..117465 - 351 WP_023100676.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PMJ88_RS33950 (PMJ88_33950) 117462..117710 - 249 WP_034017785.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
PMJ88_RS33955 (PMJ88_33955) 117707..118126 - 420 WP_057380713.1 hypothetical protein -
PMJ88_RS33960 (PMJ88_33960) 118200..118676 - 477 WP_034026837.1 single-stranded DNA-binding protein -
PMJ88_RS33965 (PMJ88_33965) 118727..119125 - 399 WP_176742248.1 hypothetical protein -
PMJ88_RS33970 (PMJ88_33970) 119134..119817 - 684 WP_034018055.1 hypothetical protein -
PMJ88_RS33975 (PMJ88_33975) 119814..120350 - 537 WP_034018056.1 hypothetical protein -
PMJ88_RS33980 (PMJ88_33980) 120347..120577 - 231 WP_034018057.1 hypothetical protein -
PMJ88_RS33985 (PMJ88_33985) 120567..122642 - 2076 WP_034018058.1 DNA cytosine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..142661 142661


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(11-112)

Antitoxin

Antitoxin PemI-like

(1-81)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12073.06 Da        Isoelectric Point: 10.1005

>T269212 WP_023100676.1 NZ_CP116726:c117465-117115 [Pseudomonas aeruginosa]
MSKRLQHQFDRGDIVSLDMGSASAQAACKALVLSPAAYNVLGLALAIPITEHDSSRYAGFAVAILLPGRTPAKGAALVNL
VRPVDLAARGAKLLGKAPQTTIDEALQRLQAVVGKD

Download         Length: 351 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8753.01 Da        Isoelectric Point: 4.1093

>AT269212 WP_034017785.1 NZ_CP116726:c117710-117462 [Pseudomonas aeruginosa]
MKTTIRAIGNSQGITIPKPLLAELGVSLGDPVDISFKDQTLVVTKVATEYDLSTLVAQCDLEAPEPPDIQCWRTATPVGN
EA

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K4Y2Z0

Antitoxin

Source ID Structure

References