269211

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 114607..115138 Replicon plasmid unnamed1
Accession NZ_CP116726
Organism Pseudomonas aeruginosa strain 2881

Toxin (Protein)


Gene name relE Uniprot ID A0A2K4Y311
Locus tag PMJ88_RS33925 Protein ID WP_023100672.1
Coordinates 114857..115138 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID W2D9V6
Locus tag PMJ88_RS33920 Protein ID WP_020303033.1
Coordinates 114607..114870 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PMJ88_RS33890 (PMJ88_33890) 110301..110618 + 318 WP_171947059.1 hypothetical protein -
PMJ88_RS33895 (PMJ88_33895) 110775..111272 + 498 WP_023100668.1 hypothetical protein -
PMJ88_RS33900 (PMJ88_33900) 111265..111441 + 177 WP_153549643.1 hypothetical protein -
PMJ88_RS33905 (PMJ88_33905) 111459..112817 + 1359 WP_023100669.1 replicative DNA helicase -
PMJ88_RS33910 (PMJ88_33910) 112817..113308 + 492 WP_023100670.1 hypothetical protein -
PMJ88_RS33915 (PMJ88_33915) 113540..114283 + 744 WP_023100671.1 glyoxalase superfamily protein -
PMJ88_RS33920 (PMJ88_33920) 114607..114870 + 264 WP_020303033.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PMJ88_RS33925 (PMJ88_33925) 114857..115138 + 282 WP_023100672.1 type II toxin-antitoxin system YafQ family toxin Toxin
PMJ88_RS33930 (PMJ88_33930) 115175..115510 + 336 WP_023100673.1 hypothetical protein -
PMJ88_RS33935 (PMJ88_33935) 115892..116344 + 453 WP_023100674.1 hypothetical protein -
PMJ88_RS33940 (PMJ88_33940) 116393..117115 - 723 WP_031634065.1 hypothetical protein -
PMJ88_RS33945 (PMJ88_33945) 117115..117465 - 351 WP_023100676.1 type II toxin-antitoxin system PemK/MazF family toxin -
PMJ88_RS33950 (PMJ88_33950) 117462..117710 - 249 WP_034017785.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
PMJ88_RS33955 (PMJ88_33955) 117707..118126 - 420 WP_057380713.1 hypothetical protein -
PMJ88_RS33960 (PMJ88_33960) 118200..118676 - 477 WP_034026837.1 single-stranded DNA-binding protein -
PMJ88_RS33965 (PMJ88_33965) 118727..119125 - 399 WP_176742248.1 hypothetical protein -
PMJ88_RS33970 (PMJ88_33970) 119134..119817 - 684 WP_034018055.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..142661 142661


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(2-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-84)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10724.19 Da        Isoelectric Point: 9.0277

>T269211 WP_023100672.1 NZ_CP116726:114857-115138 [Pseudomonas aeruginosa]
MRTIEQTSRFKRDYKREAKGPHRQTLASDFVAIVTALANDQPLAEKHRDHALNGDWKDHRDCHIKPDLVLIYRKPDDAVL
QLVRLGSHSELGL

Download         Length: 282 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9471.95 Da        Isoelectric Point: 4.8096

>AT269211 WP_020303033.1 NZ_CP116726:114607-114870 [Pseudomonas aeruginosa]
MSANAVVRARIDEHIKEEATVVLAAMGLTVSDAFRIMLTRVAREKALPFEPLIPNATTIEAMKEARRGGLKSFASVEDLM
ADLNADD

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K4Y311

Antitoxin

Source ID Structure
AlphaFold DB A0A0W0N2R7

References