Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5714940..5715526 | Replicon | chromosome |
Accession | NZ_CP116725 | ||
Organism | Pseudomonas aeruginosa strain 2881 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | PMJ88_RS26875 | Protein ID | WP_003120987.1 |
Coordinates | 5715227..5715526 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PMJ88_RS26870 | Protein ID | WP_003448662.1 |
Coordinates | 5714940..5715230 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ88_RS26845 (PMJ88_26845) | 5710091..5710300 | + | 210 | WP_003105733.1 | cold-shock protein | - |
PMJ88_RS26850 (PMJ88_26850) | 5710522..5712411 | + | 1890 | WP_016851610.1 | hypothetical protein | - |
PMJ88_RS26855 (PMJ88_26855) | 5712408..5714384 | + | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
PMJ88_RS26860 (PMJ88_26860) | 5714394..5714528 | + | 135 | WP_255253641.1 | hypothetical protein | - |
PMJ88_RS26865 (PMJ88_26865) | 5714525..5714869 | + | 345 | WP_016851612.1 | hypothetical protein | - |
PMJ88_RS26870 (PMJ88_26870) | 5714940..5715230 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
PMJ88_RS26875 (PMJ88_26875) | 5715227..5715526 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMJ88_RS26880 (PMJ88_26880) | 5715728..5716852 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
PMJ88_RS26885 (PMJ88_26885) | 5716852..5718561 | + | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
PMJ88_RS26890 (PMJ88_26890) | 5718565..5719890 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
PMJ88_RS26895 (PMJ88_26895) | 5719880..5720413 | + | 534 | WP_003120993.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5685703..5772001 | 86298 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T269209 WP_003120987.1 NZ_CP116725:c5715526-5715227 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|