Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 5592670..5593284 Replicon chromosome
Accession NZ_CP116725
Organism Pseudomonas aeruginosa strain 2881

Toxin (Protein)


Gene name hicA Uniprot ID A6VBH9
Locus tag PMJ88_RS26300 Protein ID WP_071534354.1
Coordinates 5593102..5593284 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A140SDX7
Locus tag PMJ88_RS26295 Protein ID WP_012077229.1
Coordinates 5592670..5593074 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PMJ88_RS26270 (PMJ88_26270) 5588810..5589520 + 711 WP_012074129.1 hypothetical protein -
PMJ88_RS26275 (PMJ88_26275) 5589517..5590437 + 921 WP_012074128.1 hypothetical protein -
PMJ88_RS26280 (PMJ88_26280) 5590434..5590973 + 540 WP_012074127.1 hypothetical protein -
PMJ88_RS26285 (PMJ88_26285) 5590973..5591671 + 699 WP_033896049.1 hypothetical protein -
PMJ88_RS26290 (PMJ88_26290) 5591656..5592627 + 972 WP_012077228.1 hypothetical protein -
PMJ88_RS26295 (PMJ88_26295) 5592670..5593074 - 405 WP_012077229.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PMJ88_RS26300 (PMJ88_26300) 5593102..5593284 - 183 WP_071534354.1 type II toxin-antitoxin system HicA family toxin Toxin
PMJ88_RS26305 (PMJ88_26305) 5593827..5594759 - 933 WP_003120918.1 ZIP family metal transporter -
PMJ88_RS26310 (PMJ88_26310) 5594778..5595389 - 612 WP_003098862.1 superoxide dismutase -
PMJ88_RS26315 (PMJ88_26315) 5595402..5595851 - 450 WP_003094369.1 hypothetical protein -
PMJ88_RS26320 (PMJ88_26320) 5595879..5597255 - 1377 WP_003098863.1 class II fumarate hydratase FumC -
PMJ88_RS26325 (PMJ88_26325) 5597248..5597643 - 396 WP_003162782.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 5555790..5593284 37494


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6702.74 Da        Isoelectric Point: 10.4826

>T269208 WP_071534354.1 NZ_CP116725:c5593284-5593102 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14670.54 Da        Isoelectric Point: 4.4315

>AT269208 WP_012077229.1 NZ_CP116725:c5593074-5592670 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A6VBH9

Antitoxin

Source ID Structure
AlphaFold DB A0A140SDX7

References