Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2929255..2930297 | Replicon | chromosome |
Accession | NZ_CP116725 | ||
Organism | Pseudomonas aeruginosa strain 2881 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PMJ88_RS14025 | Protein ID | WP_003153636.1 |
Coordinates | 2929722..2930297 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PMJ88_RS14020 | Protein ID | WP_003050245.1 |
Coordinates | 2929255..2929725 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ88_RS13985 (PMJ88_13985) | 2924647..2926065 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
PMJ88_RS13990 (PMJ88_13990) | 2926055..2926966 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
PMJ88_RS13995 (PMJ88_13995) | 2926963..2927655 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
PMJ88_RS14000 (PMJ88_14000) | 2927652..2928050 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
PMJ88_RS14005 (PMJ88_14005) | 2928062..2928421 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PMJ88_RS14010 (PMJ88_14010) | 2928438..2928671 | - | 234 | WP_023101201.1 | TIGR03758 family integrating conjugative element protein | - |
PMJ88_RS14015 (PMJ88_14015) | 2928668..2929051 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PMJ88_RS14020 (PMJ88_14020) | 2929255..2929725 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PMJ88_RS14025 (PMJ88_14025) | 2929722..2930297 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PMJ88_RS14030 (PMJ88_14030) | 2930315..2931229 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
PMJ88_RS14035 (PMJ88_14035) | 2931226..2931696 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PMJ88_RS14040 (PMJ88_14040) | 2931693..2932193 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PMJ88_RS14045 (PMJ88_14045) | 2932193..2933095 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
PMJ88_RS14050 (PMJ88_14050) | 2933134..2933859 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T269205 WP_003153636.1 NZ_CP116725:2929722-2930297 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT269205 WP_003050245.1 NZ_CP116725:2929255-2929725 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|