Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2634420..2634936 | Replicon | chromosome |
| Accession | NZ_CP116725 | ||
| Organism | Pseudomonas aeruginosa strain 2881 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3R8UIH5 |
| Locus tag | PMJ88_RS12680 | Protein ID | WP_025297453.1 |
| Coordinates | 2634655..2634936 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A3R8UIM7 |
| Locus tag | PMJ88_RS12675 | Protein ID | WP_025297454.1 |
| Coordinates | 2634420..2634665 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PMJ88_RS12655 (PMJ88_12655) | 2629542..2629871 | - | 330 | WP_031692728.1 | hypothetical protein | - |
| PMJ88_RS12660 (PMJ88_12660) | 2630219..2630887 | + | 669 | WP_071534660.1 | hypothetical protein | - |
| PMJ88_RS12665 (PMJ88_12665) | 2630884..2631990 | + | 1107 | WP_025297456.1 | XRE family transcriptional regulator | - |
| PMJ88_RS12670 (PMJ88_12670) | 2632121..2634262 | + | 2142 | WP_025297455.1 | hypothetical protein | - |
| PMJ88_RS12675 (PMJ88_12675) | 2634420..2634665 | + | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| PMJ88_RS12680 (PMJ88_12680) | 2634655..2634936 | + | 282 | WP_025297453.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PMJ88_RS12685 (PMJ88_12685) | 2635342..2635923 | - | 582 | WP_033895412.1 | plasmid pRiA4b ORF-3 family protein | - |
| PMJ88_RS12690 (PMJ88_12690) | 2635937..2636812 | - | 876 | WP_033895413.1 | WYL domain-containing protein | - |
| PMJ88_RS12695 (PMJ88_12695) | 2636941..2638521 | + | 1581 | WP_063837559.1 | DNA recombination protein RmuC | - |
| PMJ88_RS12700 (PMJ88_12700) | 2638545..2638937 | + | 393 | WP_227274803.1 | hypothetical protein | - |
| PMJ88_RS12705 (PMJ88_12705) | 2638921..2639193 | + | 273 | WP_227274804.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2620171..2687318 | 67147 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.61 Da Isoelectric Point: 10.6249
>T269204 WP_025297453.1 NZ_CP116725:2634655-2634936 [Pseudomonas aeruginosa]
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8UIH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8UIM7 |