Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 5640177..5640791 Replicon chromosome
Accession NZ_CP116724
Organism Pseudomonas aeruginosa strain 2880

Toxin (Protein)


Gene name hicA Uniprot ID A6VBH9
Locus tag PMJ92_RS26655 Protein ID WP_071534354.1
Coordinates 5640609..5640791 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A140SDX7
Locus tag PMJ92_RS26650 Protein ID WP_012077229.1
Coordinates 5640177..5640581 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PMJ92_RS26625 (PMJ92_26625) 5636317..5637027 + 711 WP_012074129.1 hypothetical protein -
PMJ92_RS26630 (PMJ92_26630) 5637024..5637944 + 921 WP_012074128.1 hypothetical protein -
PMJ92_RS26635 (PMJ92_26635) 5637941..5638480 + 540 WP_012074127.1 hypothetical protein -
PMJ92_RS26640 (PMJ92_26640) 5638480..5639178 + 699 WP_033896049.1 hypothetical protein -
PMJ92_RS26645 (PMJ92_26645) 5639163..5640134 + 972 WP_012077228.1 hypothetical protein -
PMJ92_RS26650 (PMJ92_26650) 5640177..5640581 - 405 WP_012077229.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PMJ92_RS26655 (PMJ92_26655) 5640609..5640791 - 183 WP_071534354.1 type II toxin-antitoxin system HicA family toxin Toxin
PMJ92_RS26660 (PMJ92_26660) 5641334..5642266 - 933 WP_003120918.1 ZIP family metal transporter -
PMJ92_RS26665 (PMJ92_26665) 5642285..5642896 - 612 WP_003098862.1 superoxide dismutase -
PMJ92_RS26670 (PMJ92_26670) 5642909..5643358 - 450 WP_003094369.1 hypothetical protein -
PMJ92_RS26675 (PMJ92_26675) 5643386..5644762 - 1377 WP_003098863.1 class II fumarate hydratase FumC -
PMJ92_RS26680 (PMJ92_26680) 5644755..5645150 - 396 WP_003162782.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 5607134..5640791 33657


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6702.74 Da        Isoelectric Point: 10.4826

>T269200 WP_071534354.1 NZ_CP116724:c5640791-5640609 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14670.54 Da        Isoelectric Point: 4.4315

>AT269200 WP_012077229.1 NZ_CP116724:c5640581-5640177 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A6VBH9

Antitoxin

Source ID Structure
AlphaFold DB A0A140SDX7

References