Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2730993..2731509 | Replicon | chromosome |
Accession | NZ_CP116724 | ||
Organism | Pseudomonas aeruginosa strain 2880 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3R8UIH5 |
Locus tag | PMJ92_RS13085 | Protein ID | WP_025297453.1 |
Coordinates | 2731228..2731509 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A3R8UIM7 |
Locus tag | PMJ92_RS13080 | Protein ID | WP_025297454.1 |
Coordinates | 2730993..2731238 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ92_RS13060 (PMJ92_13060) | 2726115..2726444 | - | 330 | WP_031692728.1 | hypothetical protein | - |
PMJ92_RS13065 (PMJ92_13065) | 2726792..2727460 | + | 669 | WP_071534660.1 | hypothetical protein | - |
PMJ92_RS13070 (PMJ92_13070) | 2727457..2728563 | + | 1107 | WP_025297456.1 | XRE family transcriptional regulator | - |
PMJ92_RS13075 (PMJ92_13075) | 2728694..2730835 | + | 2142 | WP_025297455.1 | hypothetical protein | - |
PMJ92_RS13080 (PMJ92_13080) | 2730993..2731238 | + | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
PMJ92_RS13085 (PMJ92_13085) | 2731228..2731509 | + | 282 | WP_025297453.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMJ92_RS13090 (PMJ92_13090) | 2731915..2732496 | - | 582 | WP_033895412.1 | plasmid pRiA4b ORF-3 family protein | - |
PMJ92_RS13095 (PMJ92_13095) | 2732510..2733385 | - | 876 | WP_033895413.1 | WYL domain-containing protein | - |
PMJ92_RS13100 (PMJ92_13100) | 2733514..2735094 | + | 1581 | WP_063837559.1 | DNA recombination protein RmuC | - |
PMJ92_RS13105 (PMJ92_13105) | 2735118..2735510 | + | 393 | WP_227274803.1 | hypothetical protein | - |
PMJ92_RS13110 (PMJ92_13110) | 2735494..2735766 | + | 273 | WP_227274804.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2716744..2781523 | 64779 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.61 Da Isoelectric Point: 10.6249
>T269197 WP_025297453.1 NZ_CP116724:2731228-2731509 [Pseudomonas aeruginosa]
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8UIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8UIM7 |