Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 2589625..2590667 Replicon chromosome
Accession NZ_CP116724
Organism Pseudomonas aeruginosa strain 2880

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag PMJ92_RS12240 Protein ID WP_003153636.1
Coordinates 2590092..2590667 (+) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag PMJ92_RS12235 Protein ID WP_003050245.1
Coordinates 2589625..2590095 (+) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PMJ92_RS12200 (PMJ92_12200) 2585017..2586435 - 1419 WP_006226029.1 TIGR03752 family integrating conjugative element protein -
PMJ92_RS12205 (PMJ92_12205) 2586425..2587336 - 912 WP_006226028.1 TIGR03749 family integrating conjugative element protein -
PMJ92_RS12210 (PMJ92_12210) 2587333..2588025 - 693 WP_003090182.1 TIGR03746 family integrating conjugative element protein -
PMJ92_RS12215 (PMJ92_12215) 2588022..2588420 - 399 WP_003050133.1 TIGR03750 family conjugal transfer protein -
PMJ92_RS12220 (PMJ92_12220) 2588432..2588791 - 360 WP_003090173.1 TIGR03745 family integrating conjugative element membrane protein -
PMJ92_RS12225 (PMJ92_12225) 2588808..2589041 - 234 WP_023101201.1 TIGR03758 family integrating conjugative element protein -
PMJ92_RS12230 (PMJ92_12230) 2589038..2589421 - 384 WP_003090167.1 RAQPRD family integrative conjugative element protein -
PMJ92_RS12235 (PMJ92_12235) 2589625..2590095 + 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
PMJ92_RS12240 (PMJ92_12240) 2590092..2590667 + 576 WP_003153636.1 PIN domain-containing protein Toxin
PMJ92_RS12245 (PMJ92_12245) 2590685..2591599 + 915 WP_016852809.1 AAA family ATPase -
PMJ92_RS12250 (PMJ92_12250) 2591596..2592066 + 471 WP_003090160.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
PMJ92_RS12255 (PMJ92_12255) 2592063..2592563 + 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
PMJ92_RS12260 (PMJ92_12260) 2592563..2593465 + 903 WP_003090158.1 CBASS oligonucleotide cyclase -
PMJ92_RS12265 (PMJ92_12265) 2593504..2594229 + 726 WP_003050273.1 CBASS effector endonuclease NucC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2512688..2636159 123471


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21629.78 Da        Isoelectric Point: 5.9995

>T269196 WP_003153636.1 NZ_CP116724:2590092-2590667 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT269196 WP_003050245.1 NZ_CP116724:2589625-2590095 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References