Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2980782..2981824 | Replicon | chromosome |
Accession | NZ_CP116722 | ||
Organism | Pseudomonas aeruginosa strain 2868 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PMJ90_RS14225 | Protein ID | WP_003153636.1 |
Coordinates | 2981249..2981824 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PMJ90_RS14220 | Protein ID | WP_003050245.1 |
Coordinates | 2980782..2981252 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ90_RS14185 (PMJ90_14185) | 2976174..2977592 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
PMJ90_RS14190 (PMJ90_14190) | 2977582..2978493 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
PMJ90_RS14195 (PMJ90_14195) | 2978490..2979182 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
PMJ90_RS14200 (PMJ90_14200) | 2979179..2979577 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
PMJ90_RS14205 (PMJ90_14205) | 2979589..2979948 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PMJ90_RS14210 (PMJ90_14210) | 2979965..2980198 | - | 234 | WP_023101201.1 | TIGR03758 family integrating conjugative element protein | - |
PMJ90_RS14215 (PMJ90_14215) | 2980195..2980578 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PMJ90_RS14220 (PMJ90_14220) | 2980782..2981252 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PMJ90_RS14225 (PMJ90_14225) | 2981249..2981824 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PMJ90_RS14230 (PMJ90_14230) | 2981842..2982756 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
PMJ90_RS14235 (PMJ90_14235) | 2982753..2983223 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PMJ90_RS14240 (PMJ90_14240) | 2983220..2983720 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PMJ90_RS14245 (PMJ90_14245) | 2983720..2984622 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
PMJ90_RS14250 (PMJ90_14250) | 2984661..2985386 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T269190 WP_003153636.1 NZ_CP116722:2981249-2981824 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT269190 WP_003050245.1 NZ_CP116722:2980782-2981252 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|