Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2688820..2689336 | Replicon | chromosome |
Accession | NZ_CP116722 | ||
Organism | Pseudomonas aeruginosa strain 2868 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3R8UIH5 |
Locus tag | PMJ90_RS12915 | Protein ID | WP_025297453.1 |
Coordinates | 2689055..2689336 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A3R8UIM7 |
Locus tag | PMJ90_RS12910 | Protein ID | WP_025297454.1 |
Coordinates | 2688820..2689065 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ90_RS12890 (PMJ90_12890) | 2683942..2684271 | - | 330 | WP_031692728.1 | hypothetical protein | - |
PMJ90_RS12895 (PMJ90_12895) | 2684619..2685287 | + | 669 | WP_071534660.1 | hypothetical protein | - |
PMJ90_RS12900 (PMJ90_12900) | 2685284..2686390 | + | 1107 | WP_025297456.1 | XRE family transcriptional regulator | - |
PMJ90_RS12905 (PMJ90_12905) | 2686521..2688662 | + | 2142 | WP_025297455.1 | hypothetical protein | - |
PMJ90_RS12910 (PMJ90_12910) | 2688820..2689065 | + | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
PMJ90_RS12915 (PMJ90_12915) | 2689055..2689336 | + | 282 | WP_025297453.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMJ90_RS12920 (PMJ90_12920) | 2689742..2690323 | - | 582 | WP_033895412.1 | plasmid pRiA4b ORF-3 family protein | - |
PMJ90_RS12925 (PMJ90_12925) | 2690337..2691212 | - | 876 | WP_033895413.1 | WYL domain-containing protein | - |
PMJ90_RS12930 (PMJ90_12930) | 2691341..2692921 | + | 1581 | WP_063837559.1 | DNA recombination protein RmuC | - |
PMJ90_RS12935 (PMJ90_12935) | 2692945..2693337 | + | 393 | WP_227274803.1 | hypothetical protein | - |
PMJ90_RS12940 (PMJ90_12940) | 2693321..2693593 | + | 273 | WP_227274804.1 | hypothetical protein | - |
PMJ90_RS12945 (PMJ90_12945) | 2693757..2693888 | + | 132 | WP_272218011.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2672055..2739265 | 67210 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.61 Da Isoelectric Point: 10.6249
>T269189 WP_025297453.1 NZ_CP116722:2689055-2689336 [Pseudomonas aeruginosa]
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8UIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8UIM7 |