Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 5640090..5640704 Replicon chromosome
Accession NZ_CP116721
Organism Pseudomonas aeruginosa strain 2867

Toxin (Protein)


Gene name hicA Uniprot ID A6VBH9
Locus tag PMJ93_RS26555 Protein ID WP_071534354.1
Coordinates 5640522..5640704 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A140SDX7
Locus tag PMJ93_RS26550 Protein ID WP_012077229.1
Coordinates 5640090..5640494 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PMJ93_RS26525 (PMJ93_26525) 5636230..5636940 + 711 WP_012074129.1 hypothetical protein -
PMJ93_RS26530 (PMJ93_26530) 5636937..5637857 + 921 WP_012074128.1 hypothetical protein -
PMJ93_RS26535 (PMJ93_26535) 5637854..5638393 + 540 WP_012074127.1 hypothetical protein -
PMJ93_RS26540 (PMJ93_26540) 5638393..5639091 + 699 WP_033896049.1 hypothetical protein -
PMJ93_RS26545 (PMJ93_26545) 5639076..5640047 + 972 WP_012077228.1 hypothetical protein -
PMJ93_RS26550 (PMJ93_26550) 5640090..5640494 - 405 WP_012077229.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PMJ93_RS26555 (PMJ93_26555) 5640522..5640704 - 183 WP_071534354.1 type II toxin-antitoxin system HicA family toxin Toxin
PMJ93_RS26560 (PMJ93_26560) 5641247..5642179 - 933 WP_003120918.1 ZIP family metal transporter -
PMJ93_RS26565 (PMJ93_26565) 5642198..5642809 - 612 WP_003098862.1 superoxide dismutase -
PMJ93_RS26570 (PMJ93_26570) 5642822..5643271 - 450 WP_003094369.1 hypothetical protein -
PMJ93_RS26575 (PMJ93_26575) 5643299..5644675 - 1377 WP_003098863.1 class II fumarate hydratase FumC -
PMJ93_RS26580 (PMJ93_26580) 5644668..5645063 - 396 WP_003162782.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 5605932..5640704 34772


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6702.74 Da        Isoelectric Point: 10.4826

>T269185 WP_071534354.1 NZ_CP116721:c5640704-5640522 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14670.54 Da        Isoelectric Point: 4.4315

>AT269185 WP_012077229.1 NZ_CP116721:c5640494-5640090 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A6VBH9

Antitoxin

Source ID Structure
AlphaFold DB A0A140SDX7

References