Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 5640090..5640704 | Replicon | chromosome |
Accession | NZ_CP116721 | ||
Organism | Pseudomonas aeruginosa strain 2867 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A6VBH9 |
Locus tag | PMJ93_RS26555 | Protein ID | WP_071534354.1 |
Coordinates | 5640522..5640704 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A140SDX7 |
Locus tag | PMJ93_RS26550 | Protein ID | WP_012077229.1 |
Coordinates | 5640090..5640494 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ93_RS26525 (PMJ93_26525) | 5636230..5636940 | + | 711 | WP_012074129.1 | hypothetical protein | - |
PMJ93_RS26530 (PMJ93_26530) | 5636937..5637857 | + | 921 | WP_012074128.1 | hypothetical protein | - |
PMJ93_RS26535 (PMJ93_26535) | 5637854..5638393 | + | 540 | WP_012074127.1 | hypothetical protein | - |
PMJ93_RS26540 (PMJ93_26540) | 5638393..5639091 | + | 699 | WP_033896049.1 | hypothetical protein | - |
PMJ93_RS26545 (PMJ93_26545) | 5639076..5640047 | + | 972 | WP_012077228.1 | hypothetical protein | - |
PMJ93_RS26550 (PMJ93_26550) | 5640090..5640494 | - | 405 | WP_012077229.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PMJ93_RS26555 (PMJ93_26555) | 5640522..5640704 | - | 183 | WP_071534354.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PMJ93_RS26560 (PMJ93_26560) | 5641247..5642179 | - | 933 | WP_003120918.1 | ZIP family metal transporter | - |
PMJ93_RS26565 (PMJ93_26565) | 5642198..5642809 | - | 612 | WP_003098862.1 | superoxide dismutase | - |
PMJ93_RS26570 (PMJ93_26570) | 5642822..5643271 | - | 450 | WP_003094369.1 | hypothetical protein | - |
PMJ93_RS26575 (PMJ93_26575) | 5643299..5644675 | - | 1377 | WP_003098863.1 | class II fumarate hydratase FumC | - |
PMJ93_RS26580 (PMJ93_26580) | 5644668..5645063 | - | 396 | WP_003162782.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 5605932..5640704 | 34772 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6702.74 Da Isoelectric Point: 10.4826
>T269185 WP_071534354.1 NZ_CP116721:c5640704-5640522 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14670.54 Da Isoelectric Point: 4.4315
>AT269185 WP_012077229.1 NZ_CP116721:c5640494-5640090 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6VBH9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A140SDX7 |