Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2935670..2936712 | Replicon | chromosome |
Accession | NZ_CP116721 | ||
Organism | Pseudomonas aeruginosa strain 2867 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PMJ93_RS13915 | Protein ID | WP_003153636.1 |
Coordinates | 2936137..2936712 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PMJ93_RS13910 | Protein ID | WP_003050245.1 |
Coordinates | 2935670..2936140 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ93_RS13875 (PMJ93_13875) | 2931062..2932480 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
PMJ93_RS13880 (PMJ93_13880) | 2932470..2933381 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
PMJ93_RS13885 (PMJ93_13885) | 2933378..2934070 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
PMJ93_RS13890 (PMJ93_13890) | 2934067..2934465 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
PMJ93_RS13895 (PMJ93_13895) | 2934477..2934836 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PMJ93_RS13900 (PMJ93_13900) | 2934853..2935086 | - | 234 | WP_023101201.1 | TIGR03758 family integrating conjugative element protein | - |
PMJ93_RS13905 (PMJ93_13905) | 2935083..2935466 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PMJ93_RS13910 (PMJ93_13910) | 2935670..2936140 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PMJ93_RS13915 (PMJ93_13915) | 2936137..2936712 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PMJ93_RS13920 (PMJ93_13920) | 2936730..2937644 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
PMJ93_RS13925 (PMJ93_13925) | 2937641..2938111 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PMJ93_RS13930 (PMJ93_13930) | 2938108..2938608 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PMJ93_RS13935 (PMJ93_13935) | 2938608..2939510 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
PMJ93_RS13940 (PMJ93_13940) | 2939549..2940274 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2921421..2948978 | 27557 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T269182 WP_003153636.1 NZ_CP116721:2936137-2936712 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT269182 WP_003050245.1 NZ_CP116721:2935670-2936140 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|