Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2638632..2639148 | Replicon | chromosome |
Accession | NZ_CP116721 | ||
Organism | Pseudomonas aeruginosa strain 2867 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3R8UIH5 |
Locus tag | PMJ93_RS12570 | Protein ID | WP_025297453.1 |
Coordinates | 2638867..2639148 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A3R8UIM7 |
Locus tag | PMJ93_RS12565 | Protein ID | WP_025297454.1 |
Coordinates | 2638632..2638877 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ93_RS12545 (PMJ93_12545) | 2633754..2634083 | - | 330 | WP_031692728.1 | hypothetical protein | - |
PMJ93_RS12550 (PMJ93_12550) | 2634431..2635099 | + | 669 | WP_071534660.1 | hypothetical protein | - |
PMJ93_RS12555 (PMJ93_12555) | 2635096..2636202 | + | 1107 | WP_025297456.1 | XRE family transcriptional regulator | - |
PMJ93_RS12560 (PMJ93_12560) | 2636333..2638474 | + | 2142 | WP_025297455.1 | hypothetical protein | - |
PMJ93_RS12565 (PMJ93_12565) | 2638632..2638877 | + | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
PMJ93_RS12570 (PMJ93_12570) | 2638867..2639148 | + | 282 | WP_025297453.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMJ93_RS12575 (PMJ93_12575) | 2639554..2640135 | - | 582 | WP_033895412.1 | plasmid pRiA4b ORF-3 family protein | - |
PMJ93_RS12580 (PMJ93_12580) | 2640149..2641024 | - | 876 | WP_033895413.1 | WYL domain-containing protein | - |
PMJ93_RS12585 (PMJ93_12585) | 2641153..2642733 | + | 1581 | WP_063837559.1 | DNA recombination protein RmuC | - |
PMJ93_RS12590 (PMJ93_12590) | 2642757..2643149 | + | 393 | WP_227274803.1 | hypothetical protein | - |
PMJ93_RS12595 (PMJ93_12595) | 2643133..2643405 | + | 273 | WP_227274804.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2624383..2691512 | 67129 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.61 Da Isoelectric Point: 10.6249
>T269181 WP_025297453.1 NZ_CP116721:2638867-2639148 [Pseudomonas aeruginosa]
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8UIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8UIM7 |