Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 164735..165240 | Replicon | chromosome |
Accession | NZ_CP116721 | ||
Organism | Pseudomonas aeruginosa strain 2867 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PMJ93_RS00795 | Protein ID | WP_003083773.1 |
Coordinates | 164735..165016 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | PMJ93_RS00800 | Protein ID | WP_003083775.1 |
Coordinates | 165013..165240 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ93_RS00770 (PMJ93_00770) | 159986..161335 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
PMJ93_RS00775 (PMJ93_00775) | 161384..162070 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PMJ93_RS00780 (PMJ93_00780) | 162171..162905 | + | 735 | WP_004346926.1 | GntR family transcriptional regulator | - |
PMJ93_RS00785 (PMJ93_00785) | 163085..163495 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
PMJ93_RS00790 (PMJ93_00790) | 163527..164435 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
PMJ93_RS00795 (PMJ93_00795) | 164735..165016 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PMJ93_RS00800 (PMJ93_00800) | 165013..165240 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PMJ93_RS00805 (PMJ93_00805) | 165416..166036 | - | 621 | WP_003101226.1 | hypothetical protein | - |
PMJ93_RS00810 (PMJ93_00810) | 166137..166637 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
PMJ93_RS00815 (PMJ93_00815) | 166710..167051 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PMJ93_RS00820 (PMJ93_00820) | 167133..168560 | - | 1428 | WP_003083784.1 | GABA permease | - |
PMJ93_RS00825 (PMJ93_00825) | 168729..170222 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T269179 WP_003083773.1 NZ_CP116721:c165016-164735 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|