Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 5607453..5608067 Replicon chromosome
Accession NZ_CP116720
Organism Pseudomonas aeruginosa strain 2866

Toxin (Protein)


Gene name hicA Uniprot ID A6VBH9
Locus tag PMJ84_RS26495 Protein ID WP_071534354.1
Coordinates 5607885..5608067 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A140SDX7
Locus tag PMJ84_RS26490 Protein ID WP_012077229.1
Coordinates 5607453..5607857 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PMJ84_RS26465 (PMJ84_26465) 5603593..5604303 + 711 WP_012074129.1 hypothetical protein -
PMJ84_RS26470 (PMJ84_26470) 5604300..5605220 + 921 WP_012074128.1 hypothetical protein -
PMJ84_RS26475 (PMJ84_26475) 5605217..5605756 + 540 WP_012074127.1 hypothetical protein -
PMJ84_RS26480 (PMJ84_26480) 5605756..5606454 + 699 WP_033896049.1 hypothetical protein -
PMJ84_RS26485 (PMJ84_26485) 5606439..5607410 + 972 WP_012077228.1 hypothetical protein -
PMJ84_RS26490 (PMJ84_26490) 5607453..5607857 - 405 WP_012077229.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PMJ84_RS26495 (PMJ84_26495) 5607885..5608067 - 183 WP_071534354.1 type II toxin-antitoxin system HicA family toxin Toxin
PMJ84_RS26500 (PMJ84_26500) 5608610..5609542 - 933 WP_003120918.1 ZIP family metal transporter -
PMJ84_RS26505 (PMJ84_26505) 5609561..5610172 - 612 WP_003098862.1 superoxide dismutase -
PMJ84_RS26510 (PMJ84_26510) 5610185..5610634 - 450 WP_003094369.1 hypothetical protein -
PMJ84_RS26515 (PMJ84_26515) 5610662..5612038 - 1377 WP_003098863.1 class II fumarate hydratase FumC -
PMJ84_RS26520 (PMJ84_26520) 5612031..5612426 - 396 WP_003162782.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 5570573..5608067 37494


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6702.74 Da        Isoelectric Point: 10.4826

>T269177 WP_071534354.1 NZ_CP116720:c5608067-5607885 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14670.54 Da        Isoelectric Point: 4.4315

>AT269177 WP_012077229.1 NZ_CP116720:c5607857-5607453 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A6VBH9

Antitoxin

Source ID Structure
AlphaFold DB A0A140SDX7

References