Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2888104..2889146 | Replicon | chromosome |
Accession | NZ_CP116720 | ||
Organism | Pseudomonas aeruginosa strain 2866 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PMJ84_RS13690 | Protein ID | WP_003153636.1 |
Coordinates | 2888571..2889146 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PMJ84_RS13685 | Protein ID | WP_003050245.1 |
Coordinates | 2888104..2888574 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ84_RS13650 (PMJ84_13650) | 2883496..2884914 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
PMJ84_RS13655 (PMJ84_13655) | 2884904..2885815 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
PMJ84_RS13660 (PMJ84_13660) | 2885812..2886504 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
PMJ84_RS13665 (PMJ84_13665) | 2886501..2886899 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
PMJ84_RS13670 (PMJ84_13670) | 2886911..2887270 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PMJ84_RS13675 (PMJ84_13675) | 2887287..2887520 | - | 234 | WP_023101201.1 | TIGR03758 family integrating conjugative element protein | - |
PMJ84_RS13680 (PMJ84_13680) | 2887517..2887900 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PMJ84_RS13685 (PMJ84_13685) | 2888104..2888574 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PMJ84_RS13690 (PMJ84_13690) | 2888571..2889146 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PMJ84_RS13695 (PMJ84_13695) | 2889164..2890078 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
PMJ84_RS13700 (PMJ84_13700) | 2890075..2890545 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PMJ84_RS13705 (PMJ84_13705) | 2890542..2891042 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PMJ84_RS13710 (PMJ84_13710) | 2891042..2891944 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
PMJ84_RS13715 (PMJ84_13715) | 2891983..2892708 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T269174 WP_003153636.1 NZ_CP116720:2888571-2889146 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT269174 WP_003050245.1 NZ_CP116720:2888104-2888574 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|