Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2595638..2596154 | Replicon | chromosome |
Accession | NZ_CP116720 | ||
Organism | Pseudomonas aeruginosa strain 2866 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3R8UIH5 |
Locus tag | PMJ84_RS12375 | Protein ID | WP_025297453.1 |
Coordinates | 2595873..2596154 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A3R8UIM7 |
Locus tag | PMJ84_RS12370 | Protein ID | WP_025297454.1 |
Coordinates | 2595638..2595883 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ84_RS12350 (PMJ84_12350) | 2590760..2591089 | - | 330 | WP_031692728.1 | hypothetical protein | - |
PMJ84_RS12355 (PMJ84_12355) | 2591437..2592105 | + | 669 | WP_071534660.1 | hypothetical protein | - |
PMJ84_RS12360 (PMJ84_12360) | 2592102..2593208 | + | 1107 | WP_025297456.1 | XRE family transcriptional regulator | - |
PMJ84_RS12365 (PMJ84_12365) | 2593339..2595480 | + | 2142 | WP_025297455.1 | hypothetical protein | - |
PMJ84_RS12370 (PMJ84_12370) | 2595638..2595883 | + | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
PMJ84_RS12375 (PMJ84_12375) | 2595873..2596154 | + | 282 | WP_025297453.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMJ84_RS12380 (PMJ84_12380) | 2596560..2597141 | - | 582 | WP_033895412.1 | plasmid pRiA4b ORF-3 family protein | - |
PMJ84_RS12385 (PMJ84_12385) | 2597155..2598030 | - | 876 | WP_033895413.1 | WYL domain-containing protein | - |
PMJ84_RS12390 (PMJ84_12390) | 2598159..2599739 | + | 1581 | WP_063837559.1 | DNA recombination protein RmuC | - |
PMJ84_RS12395 (PMJ84_12395) | 2599763..2600155 | + | 393 | WP_227274803.1 | hypothetical protein | - |
PMJ84_RS12400 (PMJ84_12400) | 2600139..2600411 | + | 273 | WP_227274804.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2581389..2646168 | 64779 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.61 Da Isoelectric Point: 10.6249
>T269173 WP_025297453.1 NZ_CP116720:2595873-2596154 [Pseudomonas aeruginosa]
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8UIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8UIM7 |