Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 161639..162144 | Replicon | chromosome |
Accession | NZ_CP116720 | ||
Organism | Pseudomonas aeruginosa strain 2866 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PMJ84_RS00770 | Protein ID | WP_003083773.1 |
Coordinates | 161639..161920 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | PMJ84_RS00775 | Protein ID | WP_003083775.1 |
Coordinates | 161917..162144 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ84_RS00745 (PMJ84_00745) | 156890..158239 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
PMJ84_RS00750 (PMJ84_00750) | 158288..158974 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PMJ84_RS00755 (PMJ84_00755) | 159075..159809 | + | 735 | WP_004346926.1 | GntR family transcriptional regulator | - |
PMJ84_RS00760 (PMJ84_00760) | 159989..160399 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
PMJ84_RS00765 (PMJ84_00765) | 160431..161339 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
PMJ84_RS00770 (PMJ84_00770) | 161639..161920 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PMJ84_RS00775 (PMJ84_00775) | 161917..162144 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PMJ84_RS00780 (PMJ84_00780) | 162320..162940 | - | 621 | WP_003101226.1 | hypothetical protein | - |
PMJ84_RS00785 (PMJ84_00785) | 163041..163541 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
PMJ84_RS00790 (PMJ84_00790) | 163614..163955 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PMJ84_RS00795 (PMJ84_00795) | 164037..165464 | - | 1428 | WP_003083784.1 | GABA permease | - |
PMJ84_RS00800 (PMJ84_00800) | 165633..167126 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T269171 WP_003083773.1 NZ_CP116720:c161920-161639 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|