Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 3543816..3544858 | Replicon | chromosome |
Accession | NZ_CP116718 | ||
Organism | Pseudomonas aeruginosa strain 2858 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PMJ85_RS16935 | Protein ID | WP_003153636.1 |
Coordinates | 3544283..3544858 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PMJ85_RS16930 | Protein ID | WP_003050245.1 |
Coordinates | 3543816..3544286 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ85_RS16895 (PMJ85_16895) | 3539208..3540626 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
PMJ85_RS16900 (PMJ85_16900) | 3540616..3541527 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
PMJ85_RS16905 (PMJ85_16905) | 3541524..3542216 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
PMJ85_RS16910 (PMJ85_16910) | 3542213..3542611 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
PMJ85_RS16915 (PMJ85_16915) | 3542623..3542982 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PMJ85_RS16920 (PMJ85_16920) | 3542999..3543232 | - | 234 | WP_023101201.1 | TIGR03758 family integrating conjugative element protein | - |
PMJ85_RS16925 (PMJ85_16925) | 3543229..3543612 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PMJ85_RS16930 (PMJ85_16930) | 3543816..3544286 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PMJ85_RS16935 (PMJ85_16935) | 3544283..3544858 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PMJ85_RS16940 (PMJ85_16940) | 3544876..3545790 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
PMJ85_RS16945 (PMJ85_16945) | 3545787..3546257 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PMJ85_RS16950 (PMJ85_16950) | 3546254..3546754 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PMJ85_RS16955 (PMJ85_16955) | 3546754..3547656 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
PMJ85_RS16960 (PMJ85_16960) | 3547695..3548420 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T269167 WP_003153636.1 NZ_CP116718:3544283-3544858 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT269167 WP_003050245.1 NZ_CP116718:3543816-3544286 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|