Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 3248981..3249497 | Replicon | chromosome |
Accession | NZ_CP116718 | ||
Organism | Pseudomonas aeruginosa strain 2858 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3R8UIH5 |
Locus tag | PMJ85_RS15605 | Protein ID | WP_025297453.1 |
Coordinates | 3249216..3249497 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A3R8UIM7 |
Locus tag | PMJ85_RS15600 | Protein ID | WP_025297454.1 |
Coordinates | 3248981..3249226 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ85_RS15580 (PMJ85_15580) | 3244103..3244432 | - | 330 | WP_031692728.1 | hypothetical protein | - |
PMJ85_RS15585 (PMJ85_15585) | 3244780..3245448 | + | 669 | WP_071534660.1 | hypothetical protein | - |
PMJ85_RS15590 (PMJ85_15590) | 3245445..3246551 | + | 1107 | WP_025297456.1 | XRE family transcriptional regulator | - |
PMJ85_RS15595 (PMJ85_15595) | 3246682..3248823 | + | 2142 | WP_025297455.1 | hypothetical protein | - |
PMJ85_RS15600 (PMJ85_15600) | 3248981..3249226 | + | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
PMJ85_RS15605 (PMJ85_15605) | 3249216..3249497 | + | 282 | WP_025297453.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMJ85_RS15610 (PMJ85_15610) | 3249903..3250484 | - | 582 | WP_033895412.1 | plasmid pRiA4b ORF-3 family protein | - |
PMJ85_RS15615 (PMJ85_15615) | 3250498..3251373 | - | 876 | WP_033895413.1 | WYL domain-containing protein | - |
PMJ85_RS15620 (PMJ85_15620) | 3251502..3253082 | + | 1581 | WP_063837559.1 | DNA recombination protein RmuC | - |
PMJ85_RS15625 (PMJ85_15625) | 3253106..3253498 | + | 393 | WP_227274803.1 | hypothetical protein | - |
PMJ85_RS15630 (PMJ85_15630) | 3253482..3253754 | + | 273 | WP_227274804.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3234732..3301879 | 67147 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.61 Da Isoelectric Point: 10.6249
>T269166 WP_025297453.1 NZ_CP116718:3249216-3249497 [Pseudomonas aeruginosa]
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8UIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8UIM7 |