Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1798625..1799239 Replicon chromosome
Accession NZ_CP116718
Organism Pseudomonas aeruginosa strain 2858

Toxin (Protein)


Gene name hicA Uniprot ID A6VBH9
Locus tag PMJ85_RS08535 Protein ID WP_071534354.1
Coordinates 1798625..1798807 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A140SDX7
Locus tag PMJ85_RS08540 Protein ID WP_012077229.1
Coordinates 1798835..1799239 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PMJ85_RS08510 (PMJ85_08510) 1794266..1794661 + 396 WP_003162782.1 hypothetical protein -
PMJ85_RS08515 (PMJ85_08515) 1794654..1796030 + 1377 WP_003098863.1 class II fumarate hydratase FumC -
PMJ85_RS08520 (PMJ85_08520) 1796058..1796507 + 450 WP_003094369.1 hypothetical protein -
PMJ85_RS08525 (PMJ85_08525) 1796520..1797131 + 612 WP_003098862.1 superoxide dismutase -
PMJ85_RS08530 (PMJ85_08530) 1797150..1798082 + 933 WP_003120918.1 ZIP family metal transporter -
PMJ85_RS08535 (PMJ85_08535) 1798625..1798807 + 183 WP_071534354.1 type II toxin-antitoxin system HicA family toxin Toxin
PMJ85_RS08540 (PMJ85_08540) 1798835..1799239 + 405 WP_012077229.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PMJ85_RS08545 (PMJ85_08545) 1799282..1800253 - 972 WP_012077228.1 hypothetical protein -
PMJ85_RS08550 (PMJ85_08550) 1800238..1800936 - 699 WP_033896049.1 hypothetical protein -
PMJ85_RS08555 (PMJ85_08555) 1800936..1801475 - 540 WP_012074127.1 hypothetical protein -
PMJ85_RS08560 (PMJ85_08560) 1801472..1802392 - 921 WP_012074128.1 hypothetical protein -
PMJ85_RS08565 (PMJ85_08565) 1802389..1803099 - 711 WP_012074129.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1798625..1836117 37492


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6702.74 Da        Isoelectric Point: 10.4826

>T269164 WP_071534354.1 NZ_CP116718:1798625-1798807 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14670.54 Da        Isoelectric Point: 4.4315

>AT269164 WP_012077229.1 NZ_CP116718:1798835-1799239 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A6VBH9

Antitoxin

Source ID Structure
AlphaFold DB A0A140SDX7

References