Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2872546..2873062 | Replicon | chromosome |
| Accession | NZ_CP116717 | ||
| Organism | Pseudomonas aeruginosa strain 2857 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3R8UIH5 |
| Locus tag | PMJ94_RS14015 | Protein ID | WP_025297453.1 |
| Coordinates | 2872781..2873062 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A3R8UIM7 |
| Locus tag | PMJ94_RS14010 | Protein ID | WP_025297454.1 |
| Coordinates | 2872546..2872791 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PMJ94_RS13990 (PMJ94_13990) | 2867668..2867997 | - | 330 | WP_031692728.1 | hypothetical protein | - |
| PMJ94_RS13995 (PMJ94_13995) | 2868345..2869013 | + | 669 | WP_071534660.1 | hypothetical protein | - |
| PMJ94_RS14000 (PMJ94_14000) | 2869010..2870116 | + | 1107 | WP_025297456.1 | XRE family transcriptional regulator | - |
| PMJ94_RS14005 (PMJ94_14005) | 2870247..2872388 | + | 2142 | WP_025297455.1 | hypothetical protein | - |
| PMJ94_RS14010 (PMJ94_14010) | 2872546..2872791 | + | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| PMJ94_RS14015 (PMJ94_14015) | 2872781..2873062 | + | 282 | WP_025297453.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PMJ94_RS14020 (PMJ94_14020) | 2873468..2874049 | - | 582 | WP_033895412.1 | plasmid pRiA4b ORF-3 family protein | - |
| PMJ94_RS14025 (PMJ94_14025) | 2874063..2874938 | - | 876 | WP_033895413.1 | WYL domain-containing protein | - |
| PMJ94_RS14030 (PMJ94_14030) | 2875067..2876647 | + | 1581 | WP_063837559.1 | DNA recombination protein RmuC | - |
| PMJ94_RS14035 (PMJ94_14035) | 2876671..2877063 | + | 393 | WP_227274803.1 | hypothetical protein | - |
| PMJ94_RS14040 (PMJ94_14040) | 2877047..2877319 | + | 273 | WP_227274804.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2855781..2923505 | 67724 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.61 Da Isoelectric Point: 10.6249
>T269159 WP_025297453.1 NZ_CP116717:2872781-2873062 [Pseudomonas aeruginosa]
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8UIH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8UIM7 |