Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 2731178..2732220 | Replicon | chromosome |
| Accession | NZ_CP116717 | ||
| Organism | Pseudomonas aeruginosa strain 2857 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | PMJ94_RS13170 | Protein ID | WP_003153636.1 |
| Coordinates | 2731645..2732220 (+) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | I3TV68 |
| Locus tag | PMJ94_RS13165 | Protein ID | WP_003050245.1 |
| Coordinates | 2731178..2731648 (+) | Length | 157 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PMJ94_RS13130 (PMJ94_13130) | 2726570..2727988 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
| PMJ94_RS13135 (PMJ94_13135) | 2727978..2728889 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
| PMJ94_RS13140 (PMJ94_13140) | 2728886..2729578 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
| PMJ94_RS13145 (PMJ94_13145) | 2729575..2729973 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
| PMJ94_RS13150 (PMJ94_13150) | 2729985..2730344 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| PMJ94_RS13155 (PMJ94_13155) | 2730361..2730594 | - | 234 | WP_023101201.1 | TIGR03758 family integrating conjugative element protein | - |
| PMJ94_RS13160 (PMJ94_13160) | 2730591..2730974 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
| PMJ94_RS13165 (PMJ94_13165) | 2731178..2731648 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PMJ94_RS13170 (PMJ94_13170) | 2731645..2732220 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
| PMJ94_RS13175 (PMJ94_13175) | 2732238..2733152 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
| PMJ94_RS13180 (PMJ94_13180) | 2733149..2733619 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
| PMJ94_RS13185 (PMJ94_13185) | 2733616..2734116 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
| PMJ94_RS13190 (PMJ94_13190) | 2734116..2735018 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
| PMJ94_RS13195 (PMJ94_13195) | 2735057..2735782 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2654241..2777712 | 123471 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T269158 WP_003153636.1 NZ_CP116717:2731645-2732220 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT269158 WP_003050245.1 NZ_CP116717:2731178-2731648 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|