Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2828363..2829405 | Replicon | chromosome |
Accession | NZ_CP116715 | ||
Organism | Pseudomonas aeruginosa strain 2856 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PMJ91_RS13605 | Protein ID | WP_003153636.1 |
Coordinates | 2828830..2829405 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PMJ91_RS13600 | Protein ID | WP_003050245.1 |
Coordinates | 2828363..2828833 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ91_RS13565 (PMJ91_13565) | 2823755..2825173 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
PMJ91_RS13570 (PMJ91_13570) | 2825163..2826074 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
PMJ91_RS13575 (PMJ91_13575) | 2826071..2826763 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
PMJ91_RS13580 (PMJ91_13580) | 2826760..2827158 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
PMJ91_RS13585 (PMJ91_13585) | 2827170..2827529 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PMJ91_RS13590 (PMJ91_13590) | 2827546..2827779 | - | 234 | WP_023101201.1 | TIGR03758 family integrating conjugative element protein | - |
PMJ91_RS13595 (PMJ91_13595) | 2827776..2828159 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PMJ91_RS13600 (PMJ91_13600) | 2828363..2828833 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PMJ91_RS13605 (PMJ91_13605) | 2828830..2829405 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PMJ91_RS13610 (PMJ91_13610) | 2829423..2830337 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
PMJ91_RS13615 (PMJ91_13615) | 2830334..2830804 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PMJ91_RS13620 (PMJ91_13620) | 2830801..2831301 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PMJ91_RS13625 (PMJ91_13625) | 2831301..2832203 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
PMJ91_RS13630 (PMJ91_13630) | 2832242..2832967 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T269151 WP_003153636.1 NZ_CP116715:2828830-2829405 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT269151 WP_003050245.1 NZ_CP116715:2828363-2828833 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|