Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2662328..2662844 | Replicon | chromosome |
| Accession | NZ_CP116715 | ||
| Organism | Pseudomonas aeruginosa strain 2856 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3R8UIH5 |
| Locus tag | PMJ91_RS12795 | Protein ID | WP_025297453.1 |
| Coordinates | 2662563..2662844 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A3R8UIM7 |
| Locus tag | PMJ91_RS12790 | Protein ID | WP_025297454.1 |
| Coordinates | 2662328..2662573 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PMJ91_RS12770 (PMJ91_12770) | 2657450..2657779 | - | 330 | WP_031692728.1 | hypothetical protein | - |
| PMJ91_RS12775 (PMJ91_12775) | 2658127..2658795 | + | 669 | WP_071534660.1 | hypothetical protein | - |
| PMJ91_RS12780 (PMJ91_12780) | 2658792..2659898 | + | 1107 | WP_025297456.1 | XRE family transcriptional regulator | - |
| PMJ91_RS12785 (PMJ91_12785) | 2660029..2662170 | + | 2142 | WP_025297455.1 | hypothetical protein | - |
| PMJ91_RS12790 (PMJ91_12790) | 2662328..2662573 | + | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| PMJ91_RS12795 (PMJ91_12795) | 2662563..2662844 | + | 282 | WP_025297453.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PMJ91_RS12800 (PMJ91_12800) | 2663250..2663831 | - | 582 | WP_033895412.1 | plasmid pRiA4b ORF-3 family protein | - |
| PMJ91_RS12805 (PMJ91_12805) | 2663845..2664720 | - | 876 | WP_033895413.1 | WYL domain-containing protein | - |
| PMJ91_RS12810 (PMJ91_12810) | 2664849..2666429 | + | 1581 | WP_063837559.1 | DNA recombination protein RmuC | - |
| PMJ91_RS12815 (PMJ91_12815) | 2666453..2666845 | + | 393 | WP_227274803.1 | hypothetical protein | - |
| PMJ91_RS12820 (PMJ91_12820) | 2666829..2667101 | + | 273 | WP_227274804.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2648079..2669082 | 21003 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.61 Da Isoelectric Point: 10.6249
>T269150 WP_025297453.1 NZ_CP116715:2662563-2662844 [Pseudomonas aeruginosa]
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8UIH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8UIM7 |